Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   Q433_RS15995 Genome accession   NZ_CP007409
Coordinates   3070127..3070267 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3065127..3075267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q433_RS15970 (Q433_17325) yuxO 3065403..3065783 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  Q433_RS15975 (Q433_17330) comA 3065802..3066446 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  Q433_RS15980 (Q433_17335) comP 3066527..3068839 (-) 2313 WP_038427877.1 histidine kinase Regulator
  Q433_RS15985 (Q433_17340) comX 3068855..3069076 (-) 222 WP_014114983.1 competence pheromone ComX -
  Q433_RS15990 (Q433_17345) - 3069073..3069942 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  Q433_RS15995 (Q433_17350) degQ 3070127..3070267 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  Q433_RS21680 - 3070489..3070614 (+) 126 WP_121549029.1 hypothetical protein -
  Q433_RS16000 (Q433_17360) - 3070729..3071097 (+) 369 WP_038427878.1 hypothetical protein -
  Q433_RS16005 (Q433_17365) pdeH 3071073..3072302 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  Q433_RS16010 (Q433_17370) pncB 3072439..3073911 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  Q433_RS16015 (Q433_17375) pncA 3073927..3074478 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  Q433_RS16020 (Q433_17380) yueI 3074575..3074973 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=119241 Q433_RS15995 WP_003220708.1 3070127..3070267(-) (degQ) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=119241 Q433_RS15995 WP_003220708.1 3070127..3070267(-) (degQ) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment