Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AJ82_RS14505 Genome accession   NZ_CP007244
Coordinates   3031154..3031294 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis TrigoCor1448     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3026154..3036294
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AJ82_RS14480 (AJ82_16270) - 3026481..3026864 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AJ82_RS14485 (AJ82_16275) comA 3026886..3027530 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AJ82_RS14490 (AJ82_16280) comP 3027611..3029917 (-) 2307 WP_025285190.1 sensor histidine kinase Regulator
  AJ82_RS14495 (AJ82_16285) comX 3029936..3030112 (-) 177 WP_015240484.1 competence pheromone ComX -
  AJ82_RS14500 (AJ82_16290) - 3030127..3031002 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  AJ82_RS14505 (AJ82_16295) degQ 3031154..3031294 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AJ82_RS14515 (AJ82_16305) - 3031760..3032101 (+) 342 WP_025285192.1 hypothetical protein -
  AJ82_RS14520 (AJ82_16310) - 3032108..3033331 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AJ82_RS14525 (AJ82_16315) - 3033461..3034927 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  AJ82_RS14530 (AJ82_16320) - 3034945..3035496 (-) 552 WP_025285193.1 isochorismatase family cysteine hydrolase -
  AJ82_RS14535 (AJ82_16325) - 3035593..3035991 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=118252 AJ82_RS14505 WP_003152043.1 3031154..3031294(-) (degQ) [Bacillus velezensis TrigoCor1448]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=118252 AJ82_RS14505 WP_003152043.1 3031154..3031294(-) (degQ) [Bacillus velezensis TrigoCor1448]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment