Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACOOFE_RS12800 Genome accession   NZ_OZ244138
Coordinates   2715167..2715655 (+) Length   162 a.a.
NCBI ID   WP_420415272.1    Uniprot ID   -
Organism   MAG: Roseibium sp. isolate 0362df45-af4a-42fd-816a-13a51ea0af63     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2696553..2726816 2715167..2715655 within 0


Gene organization within MGE regions


Location: 2696553..2726816
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACOOFE_RS12615 - 2696553..2697134 (+) 582 WP_420415235.1 hypothetical protein -
  ACOOFE_RS12620 - 2697171..2697629 (+) 459 WP_420415236.1 hypothetical protein -
  ACOOFE_RS12625 - 2697865..2698758 (-) 894 WP_420415237.1 tyrosine-type recombinase/integrase -
  ACOOFE_RS12630 - 2698902..2699069 (-) 168 WP_420415238.1 hypothetical protein -
  ACOOFE_RS12635 - 2699071..2699340 (-) 270 WP_420415239.1 hypothetical protein -
  ACOOFE_RS12640 - 2699343..2699603 (-) 261 WP_420415240.1 hypothetical protein -
  ACOOFE_RS12645 - 2699621..2699890 (-) 270 WP_420415241.1 hypothetical protein -
  ACOOFE_RS12650 - 2699890..2700150 (-) 261 WP_420415242.1 hypothetical protein -
  ACOOFE_RS12655 - 2700156..2700374 (-) 219 WP_420415243.1 hypothetical protein -
  ACOOFE_RS12660 - 2700384..2700524 (-) 141 WP_420415244.1 hypothetical protein -
  ACOOFE_RS12665 - 2700527..2700976 (-) 450 WP_420415245.1 hypothetical protein -
  ACOOFE_RS12670 - 2701698..2701994 (-) 297 WP_420415246.1 hypothetical protein -
  ACOOFE_RS12675 - 2702085..2702417 (-) 333 WP_420415247.1 hypothetical protein -
  ACOOFE_RS12680 - 2702584..2703168 (-) 585 WP_420415248.1 3'-5' exonuclease -
  ACOOFE_RS12685 - 2703168..2703788 (-) 621 WP_420415249.1 lambda exonuclease family protein -
  ACOOFE_RS12690 - 2703778..2704524 (-) 747 WP_420415250.1 ERF family protein -
  ACOOFE_RS12695 - 2704521..2704733 (-) 213 WP_420415251.1 hypothetical protein -
  ACOOFE_RS12700 - 2704854..2705225 (-) 372 WP_420415252.1 hypothetical protein -
  ACOOFE_RS12705 - 2705311..2705445 (-) 135 WP_420415253.1 hypothetical protein -
  ACOOFE_RS12710 - 2705532..2706014 (+) 483 WP_420415254.1 hypothetical protein -
  ACOOFE_RS12715 - 2706077..2706256 (-) 180 WP_420415255.1 hypothetical protein -
  ACOOFE_RS12720 - 2706253..2706444 (-) 192 WP_420415256.1 hypothetical protein -
  ACOOFE_RS12725 - 2706621..2707358 (+) 738 WP_420415257.1 hypothetical protein -
  ACOOFE_RS12730 - 2707800..2708057 (-) 258 WP_420415258.1 hypothetical protein -
  ACOOFE_RS12735 - 2708134..2708598 (-) 465 WP_420415259.1 helix-turn-helix domain-containing protein -
  ACOOFE_RS12740 - 2708695..2708934 (+) 240 WP_420415260.1 helix-turn-helix transcriptional regulator -
  ACOOFE_RS12745 - 2709029..2709448 (+) 420 WP_420415261.1 hypothetical protein -
  ACOOFE_RS12750 - 2709464..2709814 (+) 351 WP_420415262.1 GcrA family cell cycle regulator -
  ACOOFE_RS12755 - 2709811..2710176 (+) 366 WP_420415263.1 hypothetical protein -
  ACOOFE_RS12760 - 2710173..2710574 (+) 402 WP_420415264.1 hypothetical protein -
  ACOOFE_RS12765 - 2710571..2711308 (+) 738 WP_420415265.1 Rha family transcriptional regulator -
  ACOOFE_RS12770 - 2711305..2712090 (+) 786 WP_420415266.1 DUF1194 domain-containing protein -
  ACOOFE_RS12775 - 2712272..2712841 (+) 570 WP_420415267.1 hypothetical protein -
  ACOOFE_RS12780 - 2713015..2713722 (+) 708 WP_420415268.1 hypothetical protein -
  ACOOFE_RS12785 - 2713722..2714150 (+) 429 WP_420415269.1 hypothetical protein -
  ACOOFE_RS12790 - 2714155..2714646 (+) 492 WP_420415270.1 helix-turn-helix domain-containing protein -
  ACOOFE_RS12795 - 2714631..2715170 (+) 540 WP_420415271.1 hypothetical protein -
  ACOOFE_RS12800 ssb 2715167..2715655 (+) 489 WP_420415272.1 single-stranded DNA-binding protein Machinery gene
  ACOOFE_RS12805 - 2715667..2715879 (+) 213 WP_420415273.1 hypothetical protein -
  ACOOFE_RS12810 - 2716072..2716347 (+) 276 WP_420415274.1 hypothetical protein -
  ACOOFE_RS12815 - 2717203..2717490 (+) 288 WP_420415275.1 hypothetical protein -
  ACOOFE_RS12820 - 2717534..2717710 (+) 177 WP_420415276.1 hypothetical protein -
  ACOOFE_RS12825 - 2717977..2718174 (+) 198 WP_420415277.1 hypothetical protein -
  ACOOFE_RS12830 - 2718178..2718417 (+) 240 WP_420415278.1 hypothetical protein -
  ACOOFE_RS12835 - 2718653..2719012 (+) 360 WP_420415279.1 hypothetical protein -
  ACOOFE_RS12850 - 2719615..2719860 (+) 246 WP_420415280.1 hypothetical protein -
  ACOOFE_RS12855 - 2719870..2720172 (+) 303 WP_420415281.1 hypothetical protein -
  ACOOFE_RS12860 - 2720221..2720607 (+) 387 WP_420415282.1 helix-turn-helix domain-containing protein -
  ACOOFE_RS12865 - 2720588..2721925 (+) 1338 WP_420415283.1 DNA-packaging protein -
  ACOOFE_RS12870 - 2721963..2724083 (+) 2121 WP_420415284.1 portal protein -
  ACOOFE_RS12875 - 2724334..2724516 (+) 183 WP_420415285.1 hypothetical protein -
  ACOOFE_RS12880 - 2724600..2725544 (+) 945 WP_420415286.1 hypothetical protein -
  ACOOFE_RS12885 - 2725629..2726816 (+) 1188 WP_420415287.1 P22 phage major capsid protein family protein -

Sequence

Protein


Download         Length: 162 a.a.        Molecular weight: 18020.82 Da        Isoelectric Point: 7.0178

>NTDB_id=1170997 ACOOFE_RS12800 WP_420415272.1 2715167..2715655(+) (ssb) [MAG: Roseibium sp. isolate 0362df45-af4a-42fd-816a-13a51ea0af63]
MSSVNKVTLLGSLGADPEIRRTNDGRAIANLRLATSEKWRDKNTGEQREKTEWHRVVIFSEGLVKVAENYLRKGSKVYLE
GQLQTRKWQDQSGQDRYSTEIVMQGFNSDLVMLDGAKSGQQSGQGTSDARQKDYTDNYRPSSDYGNQGGGFGGGSMDSEI
PF

Nucleotide


Download         Length: 489 bp        

>NTDB_id=1170997 ACOOFE_RS12800 WP_420415272.1 2715167..2715655(+) (ssb) [MAG: Roseibium sp. isolate 0362df45-af4a-42fd-816a-13a51ea0af63]
ATGAGCAGCGTCAACAAAGTCACTTTATTGGGTTCGCTGGGAGCTGATCCGGAAATTCGGCGGACCAATGACGGACGCGC
GATTGCCAATCTCCGTCTCGCGACTTCCGAAAAATGGCGGGACAAAAACACCGGTGAGCAGCGCGAAAAAACCGAATGGC
ACCGTGTGGTGATTTTCTCTGAAGGTTTGGTCAAGGTCGCAGAGAATTACCTTCGCAAGGGCTCCAAGGTTTATCTCGAG
GGGCAGCTTCAAACCCGCAAGTGGCAGGACCAAAGCGGCCAAGATCGCTACTCAACTGAAATCGTAATGCAGGGTTTCAA
CAGCGATCTTGTGATGTTGGATGGTGCGAAAAGCGGTCAGCAATCCGGCCAAGGCACTTCAGACGCCCGCCAGAAGGATT
ACACCGACAACTACCGTCCTTCCTCAGACTACGGCAACCAGGGCGGTGGCTTTGGTGGTGGTTCGATGGATTCAGAAATT
CCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-104)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

51.948

95.062

0.494
  ssb Vibrio cholerae strain A1552

64.228

75.926

0.488

Multiple sequence alignment