Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AW03_RS15590 Genome accession   NZ_CP007173
Coordinates   3019453..3019593 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis HJ5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3014453..3024593
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AW03_RS15565 (AW03_029880) yuxO 3014796..3015176 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  AW03_RS15570 (AW03_029890) comA 3015194..3015838 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AW03_RS15575 (AW03_029900) comP 3015919..3018219 (-) 2301 WP_046340263.1 histidine kinase Regulator
  AW03_RS15580 (AW03_029910) comX 3018231..3018395 (-) 165 WP_015384519.1 competence pheromone ComX -
  AW03_RS15585 (AW03_029920) - 3018408..3019268 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  AW03_RS15590 (AW03_029930) degQ 3019453..3019593 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AW03_RS22115 - 3019815..3019877 (+) 63 Protein_3033 hypothetical protein -
  AW03_RS15595 (AW03_029940) - 3020055..3020423 (+) 369 WP_015483634.1 hypothetical protein -
  AW03_RS15600 (AW03_029950) pdeH 3020399..3021628 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AW03_RS15605 (AW03_029960) pncB 3021765..3023237 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AW03_RS15610 (AW03_029970) pncA 3023253..3023804 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AW03_RS15615 (AW03_029980) yueI 3023901..3024299 (-) 399 WP_015483635.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=117070 AW03_RS15590 WP_003220708.1 3019453..3019593(-) (degQ) [Bacillus subtilis HJ5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=117070 AW03_RS15590 WP_003220708.1 3019453..3019593(-) (degQ) [Bacillus subtilis HJ5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment