Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | ACH8EK_RS03815 | Genome accession | NZ_OZ197910 |
| Coordinates | 718663..719136 (+) | Length | 157 a.a. |
| NCBI ID | WP_025455985.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae isolate SGC-24-001 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 719206..769891 | 718663..719136 | flank | 70 |
Gene organization within MGE regions
Location: 718663..769891
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACH8EK_RS03815 | pilL | 718663..719136 (+) | 474 | WP_025455985.1 | PilX family type IV pilin | Machinery gene |
| ACH8EK_RS03820 | - | 719206..719514 (-) | 309 | WP_010359926.1 | AzlD family protein | - |
| ACH8EK_RS03825 | - | 719511..720221 (-) | 711 | Protein_747 | AzlC family ABC transporter permease | - |
| ACH8EK_RS03830 | dut | 720387..720839 (+) | 453 | WP_010359930.1 | dUTP diphosphatase | - |
| ACH8EK_RS03835 | dapC | 720917..722104 (+) | 1188 | WP_235270334.1 | succinyldiaminopimelate transaminase | - |
| ACH8EK_RS03840 | yaaA | 722260..723039 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| ACH8EK_RS03855 | - | 723569..724769 (+) | 1201 | Protein_751 | tyrosine-type recombinase/integrase | - |
| ACH8EK_RS03860 | - | 725125..725394 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| ACH8EK_RS03865 | - | 725589..726272 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| ACH8EK_RS03870 | - | 726553..726819 (-) | 267 | Protein_754 | hypothetical protein | - |
| ACH8EK_RS03875 | - | 726930..727145 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| ACH8EK_RS03880 | - | 727197..727688 (-) | 492 | WP_047922620.1 | siphovirus Gp157 family protein | - |
| ACH8EK_RS03885 | - | 727685..727867 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| ACH8EK_RS03890 | - | 728007..728693 (-) | 687 | WP_012503754.1 | phage replication initiation protein, NGO0469 family | - |
| ACH8EK_RS03895 | - | 728762..728923 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| ACH8EK_RS03900 | - | 728920..729195 (-) | 276 | WP_003703838.1 | NGO1622 family putative holin | - |
| ACH8EK_RS03905 | - | 729348..729680 (-) | 333 | WP_047922517.1 | hypothetical protein | - |
| ACH8EK_RS03910 | - | 729821..730084 (-) | 264 | WP_395372521.1 | hypothetical protein | - |
| ACH8EK_RS03915 | - | 730081..730557 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| ACH8EK_RS03920 | - | 730590..730790 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| ACH8EK_RS03925 | - | 730988..731401 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| ACH8EK_RS03930 | - | 731398..731859 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| ACH8EK_RS03935 | - | 731876..732313 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| ACH8EK_RS03940 | - | 732426..733142 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| ACH8EK_RS03945 | - | 733217..733447 (+) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| ACH8EK_RS03950 | - | 733527..733682 (+) | 156 | WP_003703527.1 | hypothetical protein | - |
| ACH8EK_RS03955 | - | 733659..733847 (-) | 189 | WP_047926773.1 | hypothetical protein | - |
| ACH8EK_RS03960 | - | 734021..734248 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| ACH8EK_RS03965 | - | 734245..735222 (+) | 978 | WP_395373045.1 | helix-turn-helix domain-containing protein | - |
| ACH8EK_RS03970 | - | 735236..736015 (+) | 780 | WP_025455898.1 | ATP-binding protein | - |
| ACH8EK_RS03975 | - | 736085..736315 (+) | 231 | WP_395372151.1 | hypothetical protein | - |
| ACH8EK_RS03980 | - | 736329..736784 (+) | 456 | WP_047922671.1 | DUF3310 domain-containing protein | - |
| ACH8EK_RS03985 | - | 736808..736957 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| ACH8EK_RS03990 | - | 736986..737255 (+) | 270 | WP_047921130.1 | hypothetical protein | - |
| ACH8EK_RS03995 | - | 737246..737626 (+) | 381 | WP_082295559.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACH8EK_RS04000 | - | 737643..737771 (-) | 129 | WP_256263200.1 | hypothetical protein | - |
| ACH8EK_RS04005 | - | 737893..738300 (+) | 408 | WP_047922557.1 | hypothetical protein | - |
| ACH8EK_RS04010 | - | 738361..739320 (+) | 960 | WP_123768253.1 | hypothetical protein | - |
| ACH8EK_RS04015 | - | 739599..740468 (+) | 870 | WP_010360055.1 | BRO family protein | - |
| ACH8EK_RS04020 | - | 740761..741210 (+) | 450 | WP_003689093.1 | hypothetical protein | - |
| ACH8EK_RS04025 | terL | 741272..742693 (+) | 1422 | WP_003689090.1 | phage terminase large subunit | - |
| ACH8EK_RS04030 | - | 742690..744837 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| ACH8EK_RS04035 | - | 744905..746062 (+) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| ACH8EK_RS04040 | - | 746104..747603 (+) | 1500 | WP_047922697.1 | hypothetical protein | - |
| ACH8EK_RS04045 | - | 747610..747972 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| ACH8EK_RS04050 | - | 747975..748505 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| ACH8EK_RS04055 | - | 748505..748987 (+) | 483 | WP_010360061.1 | HK97 gp10 family phage protein | - |
| ACH8EK_RS04060 | - | 748984..749412 (+) | 429 | WP_003697213.1 | hypothetical protein | - |
| ACH8EK_RS04065 | - | 749438..750211 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| ACH8EK_RS04070 | - | 750272..750601 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| ACH8EK_RS04075 | - | 750613..750879 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| ACH8EK_RS04080 | - | 750879..751478 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| ACH8EK_RS04085 | - | 751475..752329 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| ACH8EK_RS04090 | - | 752331..752762 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| ACH8EK_RS04095 | - | 752790..753068 (-) | 279 | WP_003689062.1 | helix-turn-helix domain-containing protein | - |
| ACH8EK_RS04100 | - | 753308..757453 (+) | 4146 | WP_395373061.1 | phage tail protein | - |
| ACH8EK_RS04105 | - | 757565..757870 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| ACH8EK_RS04110 | - | 757941..758411 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| ACH8EK_RS04115 | - | 758412..758744 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| ACH8EK_RS04120 | - | 759112..759459 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACH8EK_RS04125 | - | 759459..759695 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| ACH8EK_RS04130 | - | 759735..759860 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| ACH8EK_RS04135 | - | 759902..760441 (+) | 540 | WP_395373069.1 | TIGR02594 family protein | - |
| ACH8EK_RS04140 | - | 760441..760599 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| ACH8EK_RS04145 | - | 760583..760924 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| ACH8EK_RS04150 | - | 760908..761081 (+) | 174 | WP_017146757.1 | hypothetical protein | - |
| ACH8EK_RS04155 | - | 761423..761572 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| ACH8EK_RS04160 | - | 761602..764646 (+) | 3045 | WP_395373072.1 | tape measure protein | - |
| ACH8EK_RS04165 | - | 764706..765185 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| ACH8EK_RS04170 | - | 765527..766516 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| ACH8EK_RS04175 | - | 766776..766964 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| ACH8EK_RS04180 | purM | 767205..768239 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| ACH8EK_RS04185 | - | 768457..768762 (+) | 306 | WP_169335322.1 | hypothetical protein | - |
| ACH8EK_RS04190 | - | 769238..769891 (+) | 654 | WP_017147083.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17439.16 Da Isoelectric Point: 9.7327
>NTDB_id=1169716 ACH8EK_RS03815 WP_025455985.1 718663..719136(+) (pilL) [Neisseria gonorrhoeae isolate SGC-24-001]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVRLVNEGKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVRLVNEGKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=1169716 ACH8EK_RS03815 WP_025455985.1 718663..719136(+) (pilL) [Neisseria gonorrhoeae isolate SGC-24-001]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGCGGCTTGTCAATGAGGGAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGCGGCTTGTCAATGAGGGAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
93.631 |
100 |
0.936 |
| pilX | Neisseria meningitidis 8013 |
85.35 |
100 |
0.854 |