Detailed information
Overview
| Name | cqsS | Type | Regulator |
| Locus tag | ACFEL1_RS05790 | Genome accession | NZ_OZ183486 |
| Coordinates | 1198240..1198392 (+) | Length | 50 a.a. |
| NCBI ID | WP_410521703.1 | Uniprot ID | - |
| Organism | Candidatus Tisiphia endosymbiont of Oplodontha viridula isolate 5eb2ed8d-1a12-46ec-bfa5-d4467762f9a1 | ||
| Function | autoinducer sensor (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1193240..1203392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFEL1_RS05765 | - | 1193892..1194644 (-) | 753 | WP_375330788.1 | IS5 family transposase | - |
| ACFEL1_RS05770 | - | 1194977..1195711 (-) | 735 | WP_375330789.1 | TylF/MycF/NovP-related O-methyltransferase | - |
| ACFEL1_RS05775 | - | 1195729..1196262 (+) | 534 | WP_342278979.1 | sodium:solute symporter family transporter | - |
| ACFEL1_RS05780 | - | 1196297..1197280 (+) | 984 | WP_342278978.1 | hypothetical protein | - |
| ACFEL1_RS05785 | - | 1197452..1198213 (+) | 762 | WP_375330790.1 | hypothetical protein | - |
| ACFEL1_RS05790 | cqsS | 1198240..1198392 (+) | 153 | WP_410521703.1 | ATP-binding protein | Regulator |
| ACFEL1_RS05795 | - | 1198457..1198894 (+) | 438 | WP_342278976.1 | hypothetical protein | - |
| ACFEL1_RS05800 | - | 1199037..1199381 (+) | 345 | WP_342278975.1 | hypothetical protein | - |
| ACFEL1_RS05805 | - | 1199374..1199793 (-) | 420 | WP_341761837.1 | helix-turn-helix domain-containing protein | - |
| ACFEL1_RS05810 | - | 1199982..1200467 (+) | 486 | WP_375330732.1 | helix-turn-helix domain-containing protein | - |
| ACFEL1_RS05815 | - | 1200488..1200985 (+) | 498 | WP_375330791.1 | IS630 family transposase | - |
| ACFEL1_RS05820 | - | 1201246..1201458 (+) | 213 | WP_342279063.1 | hypothetical protein | - |
| ACFEL1_RS05825 | - | 1201476..1201706 (+) | 231 | WP_375330792.1 | hypothetical protein | - |
| ACFEL1_RS05830 | - | 1201703..1202098 (-) | 396 | WP_342278972.1 | transposase | - |
| ACFEL1_RS05835 | - | 1202098..1202676 (-) | 579 | WP_375330793.1 | hypothetical protein | - |
| ACFEL1_RS05840 | - | 1202751..1202939 (-) | 189 | Protein_1114 | transposase | - |
| ACFEL1_RS05845 | - | 1202979..1203137 (-) | 159 | WP_375330794.1 | TraU family protein | - |
Sequence
Protein
Download Length: 50 a.a. Molecular weight: 5660.45 Da Isoelectric Point: 6.0614
>NTDB_id=1168100 ACFEL1_RS05790 WP_410521703.1 1198240..1198392(+) (cqsS) [Candidatus Tisiphia endosymbiont of Oplodontha viridula isolate 5eb2ed8d-1a12-46ec-bfa5-d4467762f9a1]
MPFYTRRANGIGLGLSFCKKIMLSFGGDISCISEEGQYTEFQLNFPNYNT
MPFYTRRANGIGLGLSFCKKIMLSFGGDISCISEEGQYTEFQLNFPNYNT
Nucleotide
Download Length: 153 bp
>NTDB_id=1168100 ACFEL1_RS05790 WP_410521703.1 1198240..1198392(+) (cqsS) [Candidatus Tisiphia endosymbiont of Oplodontha viridula isolate 5eb2ed8d-1a12-46ec-bfa5-d4467762f9a1]
ATACCATTTTATACTAGACGTGCAAATGGTATAGGTTTAGGGTTATCTTTTTGTAAAAAAATAATGCTTTCTTTTGGTGG
TGATATATCTTGTATATCTGAAGAGGGGCAATATACAGAGTTTCAATTAAATTTCCCTAATTATAATACATAG
ATACCATTTTATACTAGACGTGCAAATGGTATAGGTTTAGGGTTATCTTTTTGTAAAAAAATAATGCTTTCTTTTGGTGG
TGATATATCTTGTATATCTGAAGAGGGGCAATATACAGAGTTTCAATTAAATTTCCCTAATTATAATACATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cqsS | Vibrio cholerae strain A1552 |
57.143 |
98 |
0.56 |
| lqsT | Legionella pneumophila subsp. pneumophila str. Philadelphia 1 |
44.681 |
94 |
0.42 |