Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   AB3214_RS00295 Genome accession   NZ_OZ061976
Coordinates   66375..66962 (+) Length   195 a.a.
NCBI ID   WP_063516798.1    Uniprot ID   A0A5P2TXP8
Organism   Schleiferilactobacillus harbinensis isolate Schleiferilactobacillus harbinensis CIRM-BIA2388     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 50708..107676 66375..66962 within 0


Gene organization within MGE regions


Location: 50708..107676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3214_RS00240 - 50708..51946 (-) 1239 WP_367367778.1 S41 family peptidase -
  AB3214_RS00245 - 52050..52949 (+) 900 WP_367367779.1 helix-turn-helix domain-containing protein -
  AB3214_RS00250 - 53115..54749 (+) 1635 WP_226911033.1 ABC-F family ATP-binding cassette domain-containing protein -
  AB3214_RS00255 - 55112..56317 (+) 1206 WP_367367780.1 RNA-guided endonuclease InsQ/TnpB family protein -
  AB3214_RS00260 abc-f 56771..58354 (-) 1584 WP_367367781.1 ribosomal protection-like ABC-F family protein -
  AB3214_RS00265 recQ 58721..60517 (+) 1797 WP_367367782.1 DNA helicase RecQ -
  AB3214_RS00270 - 60480..62099 (-) 1620 WP_367367783.1 ATP-binding cassette domain-containing protein -
  AB3214_RS00275 - 62197..63177 (+) 981 WP_146995269.1 helix-turn-helix domain-containing protein -
  AB3214_RS00280 - 63192..64805 (-) 1614 WP_146995268.1 ABC transporter ATP-binding protein -
  AB3214_RS00285 - 64976..65896 (+) 921 WP_367367784.1 hypothetical protein -
  AB3214_RS00290 rpsF 66049..66342 (+) 294 WP_027828812.1 30S ribosomal protein S6 -
  AB3214_RS00295 ssb 66375..66962 (+) 588 WP_063516798.1 single-stranded DNA-binding protein Machinery gene
  AB3214_RS00300 rpsR 67006..67245 (+) 240 WP_027828810.1 30S ribosomal protein S18 -
  AB3214_RS00305 ssb 67365..67802 (+) 438 WP_367367785.1 single-stranded DNA-binding protein Machinery gene
  AB3214_RS00310 - 67870..68493 (-) 624 WP_367367786.1 hypothetical protein -
  AB3214_RS00315 - 68659..68859 (-) 201 WP_027828808.1 cold-shock protein -
  AB3214_RS00320 - 69185..69961 (-) 777 WP_152260000.1 sulfite exporter TauE/SafE family protein -
  AB3214_RS00325 - 70073..70669 (+) 597 WP_367367787.1 TMEM175 family protein -
  AB3214_RS00330 - 70659..71438 (+) 780 WP_367367788.1 hypothetical protein -
  AB3214_RS00335 - 71423..72448 (-) 1026 WP_331243689.1 NAD-dependent epimerase/dehydratase family protein -
  AB3214_RS00340 - 72540..72995 (+) 456 WP_146995170.1 MerR family transcriptional regulator -
  AB3214_RS00345 - 73067..73999 (+) 933 WP_367367789.1 ATP-binding cassette domain-containing protein -
  AB3214_RS00350 - 73992..74705 (+) 714 WP_367367790.1 ABC transporter permease -
  AB3214_RS00355 - 74728..75441 (+) 714 WP_367367791.1 ABC transporter permease -
  AB3214_RS00360 - 75588..76088 (+) 501 WP_367367792.1 EXLDI protein -
  AB3214_RS00365 - 76136..76669 (+) 534 WP_367367793.1 TMEM175 family protein -
  AB3214_RS00370 - 76743..76988 (+) 246 WP_243892578.1 DUF3781 domain-containing protein -
  AB3214_RS00375 - 76989..77693 (-) 705 WP_367367794.1 M23 family metallopeptidase -
  AB3214_RS00380 - 77730..78383 (-) 654 WP_367367795.1 hypothetical protein -
  AB3214_RS00385 - 78424..79350 (-) 927 WP_367367796.1 sensor histidine kinase -
  AB3214_RS00390 - 79353..80030 (-) 678 WP_367367797.1 response regulator transcription factor -
  AB3214_RS00395 - 80129..81136 (-) 1008 WP_367367798.1 agmatine deiminase family protein -
  AB3214_RS00400 - 81286..81453 (-) 168 WP_155827911.1 hypothetical protein -
  AB3214_RS00405 - 81455..81937 (-) 483 WP_063516113.1 NUDIX hydrolase -
  AB3214_RS00410 - 82014..82403 (-) 390 WP_260301534.1 hypothetical protein -
  AB3214_RS00415 sdaAB 82609..83274 (+) 666 WP_367367799.1 L-serine ammonia-lyase, iron-sulfur-dependent subunit beta -
  AB3214_RS00420 sdaAA 83289..84158 (+) 870 WP_150392807.1 L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha -
  AB3214_RS00425 - 84155..84637 (+) 483 WP_367367800.1 AAA family ATPase -
  AB3214_RS00430 - 84797..86809 (+) 2013 WP_146995182.1 DHH family phosphoesterase -
  AB3214_RS00435 rplI 86837..87292 (+) 456 WP_027828796.1 50S ribosomal protein L9 -
  AB3214_RS00440 dnaB 87334..88743 (+) 1410 WP_027828795.1 replicative DNA helicase -
  AB3214_RS00445 - 89125..90429 (+) 1305 WP_027828794.1 adenylosuccinate synthase -
  AB3214_RS00450 - 90561..91490 (+) 930 WP_367367801.1 ABC transporter ATP-binding protein -
  AB3214_RS00455 - 91487..92239 (+) 753 WP_150392810.1 ABC transporter permease -
  AB3214_RS00460 - 92378..92746 (+) 369 WP_027828792.1 PadR family transcriptional regulator -
  AB3214_RS00465 - 92718..93551 (+) 834 WP_367367802.1 hypothetical protein -
  AB3214_RS00470 - 93567..94388 (+) 822 WP_051225332.1 hypothetical protein -
  AB3214_RS00475 - 94385..98299 (-) 3915 WP_367367803.1 lectin-like domain-containing protein -
  AB3214_RS00480 - 98522..99058 (+) 537 WP_063516101.1 TetR/AcrR family transcriptional regulator -
  AB3214_RS00485 - 99058..100116 (+) 1059 WP_367367804.1 ABC transporter permease -
  AB3214_RS00490 - 100131..100814 (+) 684 WP_027828787.1 ABC transporter ATP-binding protein -
  AB3214_RS00495 - 100949..101740 (+) 792 WP_027828786.1 CPBP family intramembrane glutamic endopeptidase -
  AB3214_RS00500 - 101791..102414 (+) 624 WP_367367805.1 SAP domain-containing protein -
  AB3214_RS00505 - 102411..102740 (-) 330 WP_146993864.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
  AB3214_RS00510 - 102817..103458 (-) 642 WP_367367806.1 ABC-2 transporter permease -
  AB3214_RS00515 - 103436..104176 (-) 741 WP_367367807.1 ABC transporter ATP-binding protein -
  AB3214_RS00520 - 104166..104627 (-) 462 WP_150392820.1 helix-turn-helix domain-containing protein -
  AB3214_RS00525 - 104823..105035 (+) 213 WP_027828781.1 helix-turn-helix transcriptional regulator -
  AB3214_RS00530 - 105032..105538 (+) 507 WP_146993860.1 DUF3278 domain-containing protein -
  AB3214_RS00535 - 105692..106453 (+) 762 WP_051225331.1 CPBP family intramembrane glutamic endopeptidase -
  AB3214_RS00540 - 106476..107165 (+) 690 WP_367367808.1 lysostaphin resistance A-like protein -
  AB3214_RS00545 - 107238..107468 (-) 231 WP_063516456.1 CsbD family protein -
  AB3214_RS00550 - 107503..107676 (-) 174 WP_082231185.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Sequence


Protein


Download         Length: 195 a.a.        Molecular weight: 21188.89 Da        Isoelectric Point: 4.7802

>NTDB_id=1166444 AB3214_RS00295 WP_063516798.1 66375..66962(+) (ssb) [Schleiferilactobacillus harbinensis isolate Schleiferilactobacillus harbinensis CIRM-BIA2388]
MINRVVLVGRLTRDVDLRYTQGGTAVGRFTVAVTRNFKNSQGERDSDFINCTMWRKAAENFAQFTRKGSLVGIDGRIQTH
SYENQQGQRVFVTEVVADDFALLEPKSVTDARPRDTGSDNQGGNPNQGQPYGGNNQSSYNGGQGNNQSQPPFNQNNGNSA
APNANSGAPKKDDSLSDPFADNGQPIDISDDDLPF

Nucleotide


Download         Length: 588 bp        

>NTDB_id=1166444 AB3214_RS00295 WP_063516798.1 66375..66962(+) (ssb) [Schleiferilactobacillus harbinensis isolate Schleiferilactobacillus harbinensis CIRM-BIA2388]
ATGATCAATCGTGTGGTATTAGTGGGTCGCTTGACCCGGGACGTTGATCTGCGCTACACCCAAGGCGGCACGGCTGTTGG
CCGGTTCACTGTGGCAGTAACGCGGAACTTCAAGAATTCCCAGGGCGAGCGGGACTCCGATTTCATCAATTGTACGATGT
GGCGGAAGGCGGCGGAGAATTTCGCTCAATTCACCCGCAAGGGATCGCTCGTCGGCATTGATGGCCGGATTCAAACTCAC
AGCTATGAGAATCAGCAGGGCCAACGGGTCTTCGTCACCGAAGTGGTGGCCGATGACTTCGCCTTGCTGGAACCCAAGTC
GGTCACCGATGCCCGGCCGCGGGATACTGGCAGTGACAACCAAGGCGGCAACCCGAACCAGGGTCAGCCTTACGGTGGAA
ACAACCAGTCCTCCTACAATGGCGGTCAAGGGAATAATCAGAGCCAGCCTCCTTTCAATCAGAATAATGGTAATTCTGCG
GCCCCCAATGCGAATAGCGGGGCGCCGAAGAAGGATGACTCCTTATCCGATCCATTTGCGGATAACGGTCAGCCCATCGA
CATCTCTGATGACGATTTACCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5P2TXP8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

54.872

100

0.549

  ssbA Bacillus subtilis subsp. subtilis str. 168

50.769

100

0.508


Multiple sequence alignment