Detailed information    

insolico Bioinformatically predicted

Overview

Name   comEA   Type   Machinery gene
Locus tag   AB3Y84_RS09365 Genome accession   NZ_OZ061291
Coordinates   1898758..1898904 (-) Length   48 a.a.
NCBI ID   WP_367293950.1    Uniprot ID   -
Organism   Lactococcus lactis isolate Lactococcus lactis CIRM-BIA2553     
Function   dsDNA binding to the cell surface (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1893758..1903904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3Y84_RS09340 atpB 1893920..1894633 (-) 714 WP_004255255.1 F0F1 ATP synthase subunit A -
  AB3Y84_RS09345 - 1894678..1894893 (-) 216 WP_004255250.1 F0F1 ATP synthase subunit C -
  AB3Y84_RS09350 - 1895078..1895854 (-) 777 WP_098384084.1 alpha/beta hydrolase family protein -
  AB3Y84_RS09355 comEC 1896139..1898349 (-) 2211 WP_367293948.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene
  AB3Y84_RS09360 comEA 1898330..1898770 (-) 441 WP_367293949.1 helix-hairpin-helix domain-containing protein Machinery gene
  AB3Y84_RS09365 comEA 1898758..1898904 (-) 147 WP_367293950.1 hypothetical protein Machinery gene
  AB3Y84_RS09370 - 1898964..1900325 (-) 1362 WP_029344292.1 ABC transporter permease -
  AB3Y84_RS09375 - 1900322..1901254 (-) 933 WP_004255238.1 ABC transporter ATP-binding protein -
  AB3Y84_RS09380 - 1901359..1901757 (-) 399 WP_004255236.1 hypothetical protein -
  AB3Y84_RS09385 - 1901861..1902424 (-) 564 WP_004255233.1 GNAT family N-acetyltransferase -
  AB3Y84_RS09390 - 1902597..1903775 (-) 1179 WP_098384087.1 SLC13 family permease -

Sequence

Protein


Download         Length: 48 a.a.        Molecular weight: 5453.67 Da        Isoelectric Point: 9.7265

>NTDB_id=1165710 AB3Y84_RS09365 WP_367293950.1 1898758..1898904(-) (comEA) [Lactococcus lactis isolate Lactococcus lactis CIRM-BIA2553]
MDKILEKVKEYWKMIVLVVCGLIAGGVFYVLTNGQKPTTNLSVKLWLI

Nucleotide


Download         Length: 147 bp        

>NTDB_id=1165710 AB3Y84_RS09365 WP_367293950.1 1898758..1898904(-) (comEA) [Lactococcus lactis isolate Lactococcus lactis CIRM-BIA2553]
ATGGATAAGATTTTAGAAAAAGTAAAAGAATATTGGAAAATGATTGTTTTAGTTGTTTGTGGGCTCATTGCTGGTGGGGT
TTTTTACGTTTTAACCAACGGTCAAAAGCCAACTACAAATCTGTCAGTAAAATTATGGTTGATTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Lactococcus lactis subsp. cremoris KW2

63.636

91.667

0.583

Multiple sequence alignment