Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AB3Y95_RS00040 Genome accession   NZ_OZ061245
Coordinates   9929..10483 (+) Length   184 a.a.
NCBI ID   WP_003680798.1    Uniprot ID   -
Organism   Loigolactobacillus coryniformis isolate Loigolactobacillus coryniformis CIRM-BIA2685     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1620..34087 9929..10483 within 0
IScluster/Tn 11331..12375 9929..10483 flank 848


Gene organization within MGE regions


Location: 1620..34087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3Y95_RS00010 dnaN 1620..2759 (+) 1140 WP_003677388.1 DNA polymerase III subunit beta -
  AB3Y95_RS00015 yaaA 3069..3308 (+) 240 WP_010010457.1 S4 domain-containing protein YaaA -
  AB3Y95_RS00020 recF 3308..4405 (+) 1098 WP_367296642.1 DNA replication/repair protein RecF -
  AB3Y95_RS00025 gyrB 4624..6576 (+) 1953 WP_367296643.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  AB3Y95_RS00030 gyrA 6704..9265 (+) 2562 WP_003677393.1 DNA gyrase subunit A -
  AB3Y95_RS00035 rpsF 9589..9888 (+) 300 WP_003680796.1 30S ribosomal protein S6 -
  AB3Y95_RS00040 ssb 9929..10483 (+) 555 WP_003680798.1 single-stranded DNA-binding protein Machinery gene
  AB3Y95_RS00045 rpsR 10513..10758 (+) 246 WP_003680800.1 30S ribosomal protein S18 -
  AB3Y95_RS00050 - 10893..11306 (-) 414 WP_367296644.1 tyrosine-type recombinase/integrase -
  AB3Y95_RS00055 - 11331..11594 (+) 264 WP_003606156.1 transposase -
  AB3Y95_RS00060 - 11635..11952 (+) 318 WP_367296645.1 IS3 family transposase -
  AB3Y95_RS00065 - 11965..12375 (+) 411 Protein_12 IS3 family transposase -
  AB3Y95_RS00070 - 12537..12956 (+) 420 WP_367296646.1 hypothetical protein -
  AB3Y95_RS00075 - 13116..15128 (+) 2013 WP_367296647.1 DHH family phosphoesterase -
  AB3Y95_RS00080 rplI 15192..15644 (+) 453 WP_367296648.1 50S ribosomal protein L9 -
  AB3Y95_RS00085 dnaB 15840..17246 (+) 1407 WP_003680228.1 replicative DNA helicase -
  AB3Y95_RS00090 - 17391..17537 (+) 147 WP_141707574.1 TMEM175 family protein -
  AB3Y95_RS00095 - 17571..17801 (+) 231 WP_225351712.1 hypothetical protein -
  AB3Y95_RS00100 - 18256..19548 (+) 1293 WP_367296649.1 LysM peptidoglycan-binding domain-containing protein -
  AB3Y95_RS00105 - 19597..20064 (+) 468 WP_367296650.1 hypothetical protein -
  AB3Y95_RS00110 - 20197..20739 (+) 543 WP_010010471.1 hypothetical protein -
  AB3Y95_RS00115 - 20794..21741 (-) 948 WP_367296651.1 TDT family transporter -
  AB3Y95_RS00120 - 21974..23266 (+) 1293 WP_003680679.1 adenylosuccinate synthase -
  AB3Y95_RS00125 - 23526..24323 (-) 798 WP_010010473.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  AB3Y95_RS00135 yycF 24999..25709 (+) 711 WP_010014501.1 response regulator YycF -
  AB3Y95_RS00140 walK 25932..27812 (+) 1881 WP_010010475.1 cell wall metabolism sensor histidine kinase WalK -
  AB3Y95_RS00145 - 27802..29124 (+) 1323 WP_367296652.1 YycH family regulatory protein -
  AB3Y95_RS00150 - 29124..29948 (+) 825 WP_367296653.1 two-component system regulatory protein YycI -
  AB3Y95_RS00155 - 30084..30896 (+) 813 WP_010010479.1 MBL fold metallo-hydrolase -
  AB3Y95_RS00160 - 30995..32254 (+) 1260 WP_146988496.1 S1C family serine protease -
  AB3Y95_RS00165 rlmH 32890..33369 (+) 480 WP_029507996.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  AB3Y95_RS00170 - 33512..34087 (+) 576 WP_219479774.1 helix-turn-helix domain-containing protein -

Sequence

Protein


Download         Length: 184 a.a.        Molecular weight: 19923.37 Da        Isoelectric Point: 4.7657

>NTDB_id=1165575 AB3Y95_RS00040 WP_003680798.1 9929..10483(+) (ssb) [Loigolactobacillus coryniformis isolate Loigolactobacillus coryniformis CIRM-BIA2685]
MINRVVLIGRLTRDTELRYTSGGAAVASFTLAVNRQFTNRNGEREADFINCVMWRKSAENFTNFTHKGSLVGIEGRIQTR
NYDNAEGQRVYVTEVVADNFSLLESRSADEHRQSTGGGQSSGGYNNNNQSNGFSSSNNAFNSAPQSTTNPAPSNGPASSA
NSNPNDPFANNGESIDISDDDLPF

Nucleotide


Download         Length: 555 bp        

>NTDB_id=1165575 AB3Y95_RS00040 WP_003680798.1 9929..10483(+) (ssb) [Loigolactobacillus coryniformis isolate Loigolactobacillus coryniformis CIRM-BIA2685]
ATGATCAATCGAGTAGTCCTAATTGGACGTTTGACCCGGGATACTGAATTACGTTATACCAGTGGTGGTGCAGCAGTTGC
TTCATTCACTTTAGCAGTTAATCGCCAGTTCACTAACCGTAATGGGGAACGTGAAGCTGACTTTATCAACTGTGTGATGT
GGCGTAAATCAGCCGAGAACTTTACTAATTTTACCCATAAAGGATCATTAGTAGGGATCGAAGGTCGGATTCAAACACGG
AATTATGACAACGCTGAAGGTCAACGTGTTTACGTGACTGAAGTTGTTGCCGATAACTTCTCATTGTTAGAATCACGTTC
TGCTGACGAACATCGTCAAAGTACTGGCGGTGGCCAAAGTTCTGGTGGTTATAACAATAATAATCAGTCTAACGGCTTTA
GCAGCAGTAACAACGCATTCAACTCAGCTCCTCAATCAACAACTAATCCGGCTCCTAGCAATGGTCCTGCCAGCAGCGCA
AATAGCAATCCGAATGATCCATTTGCAAATAATGGTGAATCGATTGATATTTCCGATGATGACTTGCCATTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

67.391

100

0.674
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.804

100

0.538

Multiple sequence alignment