Detailed information
Overview
| Name | cqsS | Type | Regulator |
| Locus tag | AAHN03_RS07630 | Genome accession | NZ_OZ035005 |
| Coordinates | 467310..467468 (-) | Length | 52 a.a. |
| NCBI ID | WP_410521353.1 | Uniprot ID | - |
| Organism | Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726 | ||
| Function | autoinducer sensor (predicted from homology) Competence regulation |
||
Genomic Context
Location: 462310..472468
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAHN03_RS02270 | - | 462327..462734 (+) | 408 | WP_342278967.1 | type II toxin-antitoxin system VapC family toxin | - |
| AAHN03_RS02275 | - | 462889..463155 (+) | 267 | WP_342278968.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| AAHN03_RS02280 | - | 463152..463568 (+) | 417 | WP_342278969.1 | type II toxin-antitoxin system VapC family toxin | - |
| AAHN03_RS02285 | - | 463685..463843 (+) | 159 | WP_342278970.1 | TraU family protein | - |
| AAHN03_RS02290 | - | 463883..464077 (+) | 195 | Protein_436 | transposase | - |
| AAHN03_RS02295 | - | 464146..464724 (+) | 579 | WP_342278971.1 | hypothetical protein | - |
| AAHN03_RS02300 | - | 464724..465119 (+) | 396 | WP_342278972.1 | transposase | - |
| AAHN03_RS02305 | - | 465116..465346 (-) | 231 | WP_342278973.1 | hypothetical protein | - |
| AAHN03_RS02310 | - | 465909..466328 (+) | 420 | WP_342278974.1 | helix-turn-helix transcriptional regulator | - |
| AAHN03_RS02315 | - | 466321..466665 (-) | 345 | WP_342278975.1 | hypothetical protein | - |
| AAHN03_RS02320 | - | 466808..467245 (-) | 438 | WP_342278976.1 | hypothetical protein | - |
| AAHN03_RS07630 | cqsS | 467310..467468 (-) | 159 | WP_410521353.1 | ATP-binding protein | Regulator |
| AAHN03_RS02325 | - | 467489..468250 (-) | 762 | WP_342278977.1 | hypothetical protein | - |
| AAHN03_RS02330 | - | 468422..469405 (-) | 984 | WP_342278978.1 | hypothetical protein | - |
| AAHN03_RS02335 | - | 469440..469973 (-) | 534 | WP_342278979.1 | sodium:solute symporter family transporter | - |
| AAHN03_RS02340 | - | 469991..470725 (+) | 735 | WP_342278980.1 | TylF/MycF/NovP-related O-methyltransferase | - |
| AAHN03_RS02345 | - | 471061..471462 (+) | 402 | WP_342278981.1 | hypothetical protein | - |
| AAHN03_RS02350 | - | 471740..472423 (-) | 684 | WP_342278982.1 | transposase | - |
Sequence
Protein
Download Length: 52 a.a. Molecular weight: 5920.79 Da Isoelectric Point: 6.0614
>NTDB_id=1164029 AAHN03_RS07630 WP_410521353.1 467310..467468(-) (cqsS) [Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726]
MFIPFYTRRANGIGLGLSFCKKIMLSFGGDISCISEEGQYTEFQLNFPNYNT
MFIPFYTRRANGIGLGLSFCKKIMLSFGGDISCISEEGQYTEFQLNFPNYNT
Nucleotide
Download Length: 159 bp
>NTDB_id=1164029 AAHN03_RS07630 WP_410521353.1 467310..467468(-) (cqsS) [Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726]
ATTTTTATACCATTTTATACTAGACGTGCAAATGGTATAGGTTTAGGGTTATCTTTTTGTAAAAAAATAATGCTTTCTTT
TGGTGGTGATATATCTTGTATATCTGAAGAGGGGCAATATACAGAGTTTCAATTAAATTTCCCTAATTATAATACATAG
ATTTTTATACCATTTTATACTAGACGTGCAAATGGTATAGGTTTAGGGTTATCTTTTTGTAAAAAAATAATGCTTTCTTT
TGGTGGTGATATATCTTGTATATCTGAAGAGGGGCAATATACAGAGTTTCAATTAAATTTCCCTAATTATAATACATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cqsS | Vibrio cholerae strain A1552 |
54.717 |
100 |
0.558 |
| lqsT | Legionella pneumophila subsp. pneumophila str. Philadelphia 1 |
44.681 |
90.385 |
0.404 |