Detailed information    

insolico Bioinformatically predicted

Overview


Name   cqsS   Type   Regulator
Locus tag   AAHN03_RS07630 Genome accession   NZ_OZ035005
Coordinates   467310..467468 (-) Length   52 a.a.
NCBI ID   WP_410521353.1    Uniprot ID   -
Organism   Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726     
Function   autoinducer sensor (predicted from homology)   
Competence regulation

Genomic Context


Location: 462310..472468
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHN03_RS02270 - 462327..462734 (+) 408 WP_342278967.1 type II toxin-antitoxin system VapC family toxin -
  AAHN03_RS02275 - 462889..463155 (+) 267 WP_342278968.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
  AAHN03_RS02280 - 463152..463568 (+) 417 WP_342278969.1 type II toxin-antitoxin system VapC family toxin -
  AAHN03_RS02285 - 463685..463843 (+) 159 WP_342278970.1 TraU family protein -
  AAHN03_RS02290 - 463883..464077 (+) 195 Protein_436 transposase -
  AAHN03_RS02295 - 464146..464724 (+) 579 WP_342278971.1 hypothetical protein -
  AAHN03_RS02300 - 464724..465119 (+) 396 WP_342278972.1 transposase -
  AAHN03_RS02305 - 465116..465346 (-) 231 WP_342278973.1 hypothetical protein -
  AAHN03_RS02310 - 465909..466328 (+) 420 WP_342278974.1 helix-turn-helix transcriptional regulator -
  AAHN03_RS02315 - 466321..466665 (-) 345 WP_342278975.1 hypothetical protein -
  AAHN03_RS02320 - 466808..467245 (-) 438 WP_342278976.1 hypothetical protein -
  AAHN03_RS07630 cqsS 467310..467468 (-) 159 WP_410521353.1 ATP-binding protein Regulator
  AAHN03_RS02325 - 467489..468250 (-) 762 WP_342278977.1 hypothetical protein -
  AAHN03_RS02330 - 468422..469405 (-) 984 WP_342278978.1 hypothetical protein -
  AAHN03_RS02335 - 469440..469973 (-) 534 WP_342278979.1 sodium:solute symporter family transporter -
  AAHN03_RS02340 - 469991..470725 (+) 735 WP_342278980.1 TylF/MycF/NovP-related O-methyltransferase -
  AAHN03_RS02345 - 471061..471462 (+) 402 WP_342278981.1 hypothetical protein -
  AAHN03_RS02350 - 471740..472423 (-) 684 WP_342278982.1 transposase -

Sequence


Protein


Download         Length: 52 a.a.        Molecular weight: 5920.79 Da        Isoelectric Point: 6.0614

>NTDB_id=1164029 AAHN03_RS07630 WP_410521353.1 467310..467468(-) (cqsS) [Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726]
MFIPFYTRRANGIGLGLSFCKKIMLSFGGDISCISEEGQYTEFQLNFPNYNT

Nucleotide


Download         Length: 159 bp        

>NTDB_id=1164029 AAHN03_RS07630 WP_410521353.1 467310..467468(-) (cqsS) [Candidatus Tisiphia endosymbiont of Myopa tessellatipennis isolate 54726]
ATTTTTATACCATTTTATACTAGACGTGCAAATGGTATAGGTTTAGGGTTATCTTTTTGTAAAAAAATAATGCTTTCTTT
TGGTGGTGATATATCTTGTATATCTGAAGAGGGGCAATATACAGAGTTTCAATTAAATTTCCCTAATTATAATACATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cqsS Vibrio cholerae strain A1552

54.717

100

0.558

  lqsT Legionella pneumophila subsp. pneumophila str. Philadelphia 1

44.681

90.385

0.404


Multiple sequence alignment