Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilH   Type   Machinery gene
Locus tag   ABNR90_RS03980 Genome accession   NZ_OZ021673
Coordinates   750343..751008 (-) Length   221 a.a.
NCBI ID   WP_047918678.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae isolate SGC-23-002     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 696846..760760 750343..751008 within 0


Gene organization within MGE regions


Location: 696846..760760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABNR90_RS03605 - 697894..698199 (-) 306 WP_047953262.1 hypothetical protein -
  ABNR90_RS03610 purM 698417..699451 (-) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  ABNR90_RS03615 - 700140..701129 (+) 990 WP_003689040.1 site-specific integrase -
  ABNR90_RS03620 - 701471..701950 (+) 480 WP_002241413.1 DUF4760 domain-containing protein -
  ABNR90_RS03625 - 702010..705057 (-) 3048 WP_252295680.1 tape measure protein -
  ABNR90_RS03630 - 705551..705724 (-) 174 WP_164823238.1 hypothetical protein -
  ABNR90_RS03635 - 705708..706052 (-) 345 WP_003695464.1 hypothetical protein -
  ABNR90_RS03640 - 706053..706592 (-) 540 WP_050163081.1 TIGR02594 family protein -
  ABNR90_RS03645 - 706634..706759 (-) 126 WP_255294325.1 hypothetical protein -
  ABNR90_RS03650 - 706799..707035 (+) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  ABNR90_RS03655 - 707035..707382 (+) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ABNR90_RS03660 - 707750..708082 (-) 333 WP_003691408.1 hypothetical protein -
  ABNR90_RS03665 - 708083..708553 (-) 471 WP_003691410.1 hypothetical protein -
  ABNR90_RS03670 - 708624..708929 (-) 306 WP_003689058.1 hypothetical protein -
  ABNR90_RS03675 - 709041..713186 (-) 4146 WP_252295678.1 phage tail protein -
  ABNR90_RS03680 - 713426..713704 (+) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  ABNR90_RS03685 - 713732..714163 (-) 432 WP_003689064.1 NlpC/P60 family protein -
  ABNR90_RS03690 - 714165..715019 (-) 855 WP_003698614.1 DUF2163 domain-containing protein -
  ABNR90_RS03695 - 715016..715615 (-) 600 WP_003692874.1 DUF2460 domain-containing protein -
  ABNR90_RS03700 - 715615..715881 (-) 267 WP_003689070.1 hypothetical protein -
  ABNR90_RS03705 - 715893..716222 (-) 330 WP_003692871.1 hypothetical protein -
  ABNR90_RS03710 - 716283..717056 (-) 774 WP_003691416.1 hypothetical protein -
  ABNR90_RS03715 - 717082..717510 (-) 429 WP_003689076.1 hypothetical protein -
  ABNR90_RS03720 - 717507..717989 (-) 483 WP_003703855.1 HK97 gp10 family phage protein -
  ABNR90_RS03725 - 717989..718519 (-) 531 WP_003689080.1 head-tail connector protein -
  ABNR90_RS03730 - 718522..718914 (-) 393 WP_123771580.1 hypothetical protein -
  ABNR90_RS03735 - 718921..720420 (-) 1500 WP_003689084.1 hypothetical protein -
  ABNR90_RS03740 - 720462..721619 (-) 1158 WP_010360058.1 HK97 family phage prohead protease -
  ABNR90_RS03745 - 721687..723834 (-) 2148 WP_003691423.1 phage portal protein -
  ABNR90_RS03750 terL 723831..725252 (-) 1422 WP_003697216.1 phage terminase large subunit -
  ABNR90_RS03755 - 725314..725763 (-) 450 WP_003695485.1 hypothetical protein -
  ABNR90_RS03760 - 726056..726925 (-) 870 WP_033910830.1 BRO family protein -
  ABNR90_RS03765 - 727207..728166 (-) 960 WP_123768253.1 hypothetical protein -
  ABNR90_RS03770 - 728227..728634 (-) 408 WP_047922557.1 hypothetical protein -
  ABNR90_RS03775 - 728756..728884 (+) 129 WP_256263200.1 hypothetical protein -
  ABNR90_RS03780 - 728901..729281 (-) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  ABNR90_RS03785 - 729272..729553 (-) 282 WP_003689109.1 hypothetical protein -
  ABNR90_RS03790 - 729582..729731 (-) 150 WP_003689110.1 hypothetical protein -
  ABNR90_RS03795 - 729908..730402 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  ABNR90_RS03800 - 730441..730647 (-) 207 WP_184982621.1 hypothetical protein -
  ABNR90_RS03805 - 730717..731499 (-) 783 WP_025456432.1 ATP-binding protein -
  ABNR90_RS03810 - 731514..732524 (-) 1011 WP_218422915.1 helix-turn-helix domain-containing protein -
  ABNR90_RS03815 - 732521..732748 (-) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  ABNR90_RS03820 - 732922..733110 (+) 189 WP_047926773.1 hypothetical protein -
  ABNR90_RS03825 - 733087..733242 (-) 156 WP_047923772.1 hypothetical protein -
  ABNR90_RS03830 - 733322..733558 (-) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  ABNR90_RS03835 - 733681..734343 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  ABNR90_RS03840 - 734458..734895 (+) 438 WP_003687967.1 hypothetical protein -
  ABNR90_RS03845 - 734912..735373 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  ABNR90_RS03850 - 735370..735783 (+) 414 WP_003687963.1 hypothetical protein -
  ABNR90_RS03855 - 735981..736181 (+) 201 WP_047917349.1 hypothetical protein -
  ABNR90_RS03860 - 736214..736690 (+) 477 WP_012504141.1 DUF6948 domain-containing protein -
  ABNR90_RS03865 - 736687..736974 (+) 288 WP_252295574.1 hypothetical protein -
  ABNR90_RS03870 - 737115..737447 (+) 333 WP_003687946.1 hypothetical protein -
  ABNR90_RS03875 - 737600..737878 (+) 279 WP_041421244.1 NGO1622 family putative holin -
  ABNR90_RS03880 - 737875..738036 (+) 162 WP_003691530.1 hypothetical protein -
  ABNR90_RS03885 - 738105..738791 (+) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  ABNR90_RS03890 - 738931..739113 (+) 183 WP_003691535.1 hypothetical protein -
  ABNR90_RS03895 - 739110..739601 (+) 492 WP_017147227.1 siphovirus Gp157 family protein -
  ABNR90_RS03900 - 739653..739868 (+) 216 WP_003691538.1 hypothetical protein -
  ABNR90_RS03905 - 739979..740212 (+) 234 Protein_767 hypothetical protein -
  ABNR90_RS03910 - 740526..741209 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  ABNR90_RS03915 - 741404..741673 (+) 270 WP_003687928.1 hypothetical protein -
  ABNR90_RS03920 - 742029..743225 (-) 1197 WP_017147117.1 integrase arm-type DNA-binding domain-containing protein -
  ABNR90_RS03935 yaaA 743756..744535 (-) 780 WP_003690913.1 peroxide stress protein YaaA -
  ABNR90_RS03940 dapC 744691..745878 (-) 1188 WP_003690911.1 succinyldiaminopimelate transaminase -
  ABNR90_RS03945 dut 745956..746408 (-) 453 WP_003702446.1 dUTP diphosphatase -
  ABNR90_RS03950 - 746574..747283 (+) 710 Protein_774 AzlC family ABC transporter permease -
  ABNR90_RS03955 - 747280..747588 (+) 309 WP_003706588.1 AzlD family protein -
  ABNR90_RS03960 pilL 747658..748131 (-) 474 WP_025455870.1 PilX family type IV pilin Machinery gene
  ABNR90_RS03965 pilK 748133..748744 (-) 612 WP_003687918.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  ABNR90_RS03970 pilJ 748723..749703 (-) 981 WP_010951046.1 PilW family protein Machinery gene
  ABNR90_RS03975 pilV 749700..750311 (-) 612 WP_050169631.1 type IV pilus modification protein PilV Machinery gene
  ABNR90_RS03980 pilH 750343..751008 (-) 666 WP_047918678.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  ABNR90_RS03985 dnaB 751163..752569 (-) 1407 WP_047917169.1 replicative DNA helicase -
  ABNR90_RS03990 - 752733..753314 (+) 582 WP_003698180.1 superoxide dismutase -
  ABNR90_RS03995 - 753546..754055 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  ABNR90_RS04000 - 754382..754714 (-) 333 WP_003687908.1 hypothetical protein -
  ABNR90_RS04005 cysT 754900..755738 (+) 839 Protein_785 sulfate ABC transporter permease subunit CysT -
  ABNR90_RS04010 cysW 755927..756787 (+) 861 WP_252295676.1 sulfate ABC transporter permease subunit CysW -
  ABNR90_RS04015 - 756784..757860 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  ABNR90_RS04020 ilvA 757916..759442 (-) 1527 WP_003694966.1 threonine ammonia-lyase, biosynthetic -
  ABNR90_RS04025 - 759591..760760 (+) 1170 WP_003690889.1 D-alanyl-D-alanine carboxypeptidase family protein -

Sequence


Protein


Download         Length: 221 a.a.        Molecular weight: 24613.96 Da        Isoelectric Point: 8.6140

>NTDB_id=1162860 ABNR90_RS03980 WP_047918678.1 750343..751008(-) (pilH) [Neisseria gonorrhoeae isolate SGC-23-002]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQIANLLRFSRGEAVRLNLPVYICPAQVKKDGTVD
NQCDFGKKEQGMLAFGDKNDNKAYDGDAADVFLRNVVLNDDIKDKRINYTFNHIAFGSSQPTADRVVWTFNQNGTFGYTK
DQHLASTSSFFYSDGYIQIVLTDARAVSDADRKFRSAVVLIDSSGRVEVCRKNDTRAVCKH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=1162860 ABNR90_RS03980 WP_047918678.1 750343..751008(-) (pilH) [Neisseria gonorrhoeae isolate SGC-23-002]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGCCCAAGTTAAAAAAGACGGTACGGTCGAC
AACCAATGCGACTTCGGTAAGAAGGAACAGGGGATGTTGGCTTTCGGCGACAAAAACGACAATAAGGCATATGACGGCGA
TGCTGCGGATGTTTTTCTCCGTAACGTGGTATTGAATGATGATATCAAGGATAAGCGGATTAATTACACCTTCAATCATA
TCGCTTTCGGTTCGTCTCAGCCGACCGCCGACCGTGTAGTTTGGACATTCAATCAAAACGGGACGTTCGGTTATACGAAA
GACCAGCATCTTGCAAGCACATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAGGAAATTCCGTTCGGCGGTGGTTTTGATTGACAGCAGCGGCAGGGTCGAAGTTTGTCGTAAAAACG
ATACGCGCGCCGTATGCAAACATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

86.878

100

0.869


Multiple sequence alignment