Detailed information    

insolico Bioinformatically predicted

Overview

Name   CJE1441   Type   Regulator
Locus tag   AABI57_RS06530 Genome accession   NZ_OY754852
Coordinates   1243478..1244131 (+) Length   217 a.a.
NCBI ID   WP_060786368.1    Uniprot ID   -
Organism   Campylobacter coli isolate Reference     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1224750..1271739 1243478..1244131 within 0


Gene organization within MGE regions


Location: 1224750..1271739
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABI57_RS06380 - 1224750..1225952 (-) 1203 WP_002786036.1 M23 family metallopeptidase -
  AABI57_RS06385 - 1225949..1226755 (-) 807 WP_002776224.1 FtsX-like permease family protein -
  AABI57_RS06390 - 1226742..1227407 (-) 666 WP_002776215.1 ABC transporter ATP-binding protein -
  AABI57_RS06395 trmB 1227456..1228652 (-) 1197 WP_002780917.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  AABI57_RS06400 - 1228652..1229884 (-) 1233 WP_002780915.1 fibronectin type III domain-containing protein -
  AABI57_RS06405 - 1229832..1230797 (-) 966 WP_002776205.1 RluA family pseudouridine synthase -
  AABI57_RS06410 - 1230876..1231976 (+) 1101 WP_002780911.1 FtsW/RodA/SpoVE family cell cycle protein -
  AABI57_RS06420 - 1232311..1233486 (+) 1176 WP_002787311.1 site-specific integrase -
  AABI57_RS06425 - 1233483..1233689 (-) 207 WP_002787309.1 helix-turn-helix domain-containing protein -
  AABI57_RS06430 - 1233691..1234044 (-) 354 WP_052799158.1 hypothetical protein -
  AABI57_RS06435 - 1234062..1234817 (-) 756 WP_057043282.1 site-specific DNA-methyltransferase -
  AABI57_RS06440 - 1234795..1235061 (-) 267 WP_002787304.1 hypothetical protein -
  AABI57_RS06445 - 1235045..1235415 (-) 371 Protein_1254 hypothetical protein -
  AABI57_RS06450 - 1235416..1235640 (-) 225 WP_011049924.1 hypothetical protein -
  AABI57_RS06455 - 1235649..1236410 (-) 762 WP_002869676.1 hypothetical protein -
  AABI57_RS06460 - 1236347..1236661 (-) 315 WP_060786176.1 hypothetical protein -
  AABI57_RS06465 - 1236740..1237060 (-) 321 WP_060786175.1 hypothetical protein -
  AABI57_RS06470 - 1237448..1237684 (-) 237 WP_002787289.1 hypothetical protein -
  AABI57_RS06475 - 1237698..1238465 (-) 768 WP_002787287.1 hypothetical protein -
  AABI57_RS06480 - 1238603..1238833 (-) 231 WP_002787283.1 hypothetical protein -
  AABI57_RS06485 - 1238799..1239062 (-) 264 WP_002787281.1 hypothetical protein -
  AABI57_RS06490 - 1239119..1239406 (-) 288 WP_002787279.1 YopX family protein -
  AABI57_RS06495 - 1239459..1240190 (-) 732 WP_002801548.1 phage regulatory protein/antirepressor Ant -
  AABI57_RS06500 - 1240621..1240905 (-) 285 WP_002788580.1 hypothetical protein -
  AABI57_RS06505 - 1240902..1241105 (-) 204 WP_060786371.1 hypothetical protein -
  AABI57_RS06510 - 1241320..1241703 (+) 384 WP_060786370.1 helix-turn-helix domain-containing protein -
  AABI57_RS06515 - 1241707..1242024 (+) 318 WP_060786369.1 hypothetical protein -
  AABI57_RS06520 - 1242203..1243123 (+) 921 WP_059116726.1 DUF6731 family protein -
  AABI57_RS06525 - 1243131..1243481 (+) 351 WP_048818574.1 hypothetical protein -
  AABI57_RS06530 CJE1441 1243478..1244131 (+) 654 WP_060786368.1 DNA/RNA non-specific endonuclease Regulator
  AABI57_RS06535 - 1244148..1244429 (+) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  AABI57_RS06540 - 1244443..1244640 (-) 198 WP_002870262.1 hypothetical protein -
  AABI57_RS06545 - 1244558..1244977 (-) 420 WP_060786367.1 hypothetical protein -
  AABI57_RS06550 - 1245206..1245667 (-) 462 WP_060786366.1 DUF5675 family protein -
  AABI57_RS06555 - 1245716..1246999 (-) 1284 WP_060786365.1 hypothetical protein -
  AABI57_RS06560 - 1246996..1247370 (-) 375 WP_004306042.1 DUF1353 domain-containing protein -
  AABI57_RS06565 - 1247363..1247746 (-) 384 WP_002869963.1 hypothetical protein -
  AABI57_RS06570 - 1247743..1248378 (-) 636 WP_002789149.1 DUF4376 domain-containing protein -
  AABI57_RS06575 - 1248391..1248840 (-) 450 WP_215445536.1 hypothetical protein -
  AABI57_RS06580 - 1248842..1250407 (-) 1566 WP_215445535.1 hypothetical protein -
  AABI57_RS06585 - 1250400..1251032 (-) 633 WP_002869967.1 hypothetical protein -
  AABI57_RS06590 - 1251029..1251346 (-) 318 WP_002788295.1 head-tail adaptor protein -
  AABI57_RS06595 - 1251359..1251796 (-) 438 WP_002788293.1 phage gp6-like head-tail connector protein -
  AABI57_RS06600 - 1251793..1252044 (-) 252 WP_002788291.1 hypothetical protein -
  AABI57_RS06605 - 1252055..1253221 (-) 1167 WP_002788288.1 phage major capsid protein -
  AABI57_RS06610 - 1253238..1253795 (-) 558 WP_002788287.1 HK97 family phage prohead protease -
  AABI57_RS06615 - 1253881..1254750 (-) 870 WP_002788286.1 hypothetical protein -
  AABI57_RS06620 - 1254763..1260462 (-) 5700 WP_215445534.1 hypothetical protein -
  AABI57_RS06625 - 1260522..1260860 (+) 339 WP_002788283.1 hypothetical protein -
  AABI57_RS06630 - 1260852..1261067 (-) 216 WP_002788282.1 hypothetical protein -
  AABI57_RS06635 - 1261148..1261504 (-) 357 WP_002788281.1 hypothetical protein -
  AABI57_RS06640 - 1261501..1262481 (-) 981 WP_002788279.1 hypothetical protein -
  AABI57_RS06645 - 1262628..1262852 (+) 225 WP_002869970.1 DUF6290 family protein -
  AABI57_RS06650 - 1262849..1263112 (+) 264 WP_002869971.1 type II toxin-antitoxin system RelE/ParE family toxin -
  AABI57_RS06655 - 1263100..1263450 (-) 351 WP_002788276.1 hypothetical protein -
  AABI57_RS06660 - 1263451..1263993 (-) 543 WP_002800770.1 HK97 gp10 family phage protein -
  AABI57_RS06665 - 1263990..1265162 (-) 1173 WP_002788272.1 phage portal protein -
  AABI57_RS06670 - 1265322..1265756 (-) 435 WP_002913302.1 type II toxin-antitoxin system PemK/MazF family toxin -
  AABI57_RS06675 - 1265811..1267436 (-) 1626 WP_011049938.1 terminase TerL endonuclease subunit -
  AABI57_RS06680 - 1267440..1268075 (-) 636 WP_060786215.1 P27 family phage terminase small subunit -
  AABI57_RS06685 - 1268334..1268675 (-) 342 WP_002788260.1 HNH endonuclease signature motif containing protein -
  AABI57_RS06690 - 1268662..1268952 (-) 291 WP_002788257.1 hypothetical protein -
  AABI57_RS06695 - 1269893..1270129 (+) 237 WP_002776203.1 EexN family lipoprotein -
  AABI57_RS06700 - 1270366..1271739 (-) 1374 WP_057030685.1 replicative DNA helicase -

Sequence

Protein


Download         Length: 217 a.a.        Molecular weight: 25594.02 Da        Isoelectric Point: 9.7448

>NTDB_id=1161338 AABI57_RS06530 WP_060786368.1 1243478..1244131(+) (CJE1441) [Campylobacter coli isolate Reference]
MKKLILLPLLSTLAFADYNQYKPSEDFAKYFTKQNCSQVLDKFYYINYYDYNYKGTKAVAYKLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTISNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDSNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=1161338 AABI57_RS06530 WP_060786368.1 1243478..1244131(+) (CJE1441) [Campylobacter coli isolate Reference]
ATAAAAAAACTCATACTTTTACCATTGTTATCCACTCTAGCCTTTGCTGATTATAATCAATACAAACCAAGTGAAGATTT
TGCCAAGTATTTTACTAAGCAAAACTGCTCACAAGTTTTAGATAAATTTTATTATATTAATTACTATGATTATAATTATA
AAGGCACTAAAGCTGTAGCTTATAAACTAGAAGCAGATAATCTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACTACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGGGCATACTAT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAATATTACTCCACAAAATCCAC
AAATCAATCAAAGGGTTTGGAACAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAACTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGATAGTAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(27-216)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

92.166

100

0.922
  CJE0566 Campylobacter jejuni RM1221

90.698

99.078

0.899

Multiple sequence alignment