Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   QOS64_RS13405 Genome accession   NZ_OX460973
Coordinates   2714211..2714648 (-) Length   145 a.a.
NCBI ID   WP_052827646.1    Uniprot ID   -
Organism   Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2709211..2719648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QOS64_RS13355 sinI 2709595..2709768 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QOS64_RS13360 sinR 2709802..2710137 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QOS64_RS13365 - 2710185..2710970 (-) 786 WP_007408329.1 TasA family protein -
  QOS64_RS13370 - 2711035..2711607 (-) 573 WP_136396777.1 signal peptidase I -
  QOS64_RS13375 tapA 2711591..2712262 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  QOS64_RS13380 - 2712521..2712850 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QOS64_RS13385 - 2712890..2713069 (-) 180 WP_003153093.1 YqzE family protein -
  QOS64_RS13390 comGG 2713126..2713503 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  QOS64_RS13395 comGF 2713504..2714004 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  QOS64_RS13400 comGE 2713913..2714227 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  QOS64_RS13405 comGD 2714211..2714648 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  QOS64_RS13410 comGC 2714638..2714946 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QOS64_RS13415 comGB 2714951..2715988 (-) 1038 WP_168985054.1 competence type IV pilus assembly protein ComGB Machinery gene
  QOS64_RS13420 comGA 2715975..2717045 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  QOS64_RS13425 - 2717242..2718192 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  QOS64_RS13430 - 2718338..2719639 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence

Protein


Download         Length: 145 a.a.        Molecular weight: 16263.70 Da        Isoelectric Point: 10.2475

>NTDB_id=1159453 QOS64_RS13405 WP_052827646.1 2714211..2714648(-) (comGD) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAENKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1159453 QOS64_RS13405 WP_052827646.1 2714211..2714648(-) (comGD) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAAAATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-31)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572

Multiple sequence alignment