Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QOS64_RS13355 Genome accession   NZ_OX460973
Coordinates   2709595..2709768 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2704595..2714768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QOS64_RS13340 gcvT 2705408..2706508 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  QOS64_RS13345 - 2706932..2708602 (+) 1671 WP_025284995.1 SNF2-related protein -
  QOS64_RS13350 - 2708624..2709418 (+) 795 WP_136396493.1 YqhG family protein -
  QOS64_RS13355 sinI 2709595..2709768 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QOS64_RS13360 sinR 2709802..2710137 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QOS64_RS13365 - 2710185..2710970 (-) 786 WP_007408329.1 TasA family protein -
  QOS64_RS13370 - 2711035..2711607 (-) 573 WP_136396777.1 signal peptidase I -
  QOS64_RS13375 tapA 2711591..2712262 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  QOS64_RS13380 - 2712521..2712850 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  QOS64_RS13385 - 2712890..2713069 (-) 180 WP_003153093.1 YqzE family protein -
  QOS64_RS13390 comGG 2713126..2713503 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  QOS64_RS13395 comGF 2713504..2714004 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  QOS64_RS13400 comGE 2713913..2714227 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  QOS64_RS13405 comGD 2714211..2714648 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1159450 QOS64_RS13355 WP_003153105.1 2709595..2709768(+) (sinI) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1159450 QOS64_RS13355 WP_003153105.1 2709595..2709768(+) (sinI) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment