Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   QOS64_RS02055 Genome accession   NZ_OX460973
Coordinates   411796..411915 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 406796..416915
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QOS64_RS02040 - 408408..409091 (+) 684 WP_160242544.1 response regulator transcription factor -
  QOS64_RS02045 - 409078..410511 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  QOS64_RS02050 rapC 410664..411812 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  QOS64_RS02055 phrC 411796..411915 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QOS64_RS02060 - 412064..412159 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  QOS64_RS02065 - 412254..413618 (-) 1365 WP_136396097.1 aspartate kinase -
  QOS64_RS02070 ceuB 414032..414985 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  QOS64_RS02075 - 414975..415922 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  QOS64_RS02080 - 415916..416674 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1159420 QOS64_RS02055 WP_003156334.1 411796..411915(+) (phrC) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1159420 QOS64_RS02055 WP_003156334.1 411796..411915(+) (phrC) [Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment