Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP56_RS17600 Genome accession   NZ_OX419652
Coordinates   3260310..3260450 (-) Length   46 a.a.
NCBI ID   WP_213419240.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6131     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3255310..3265450
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP56_RS17575 (NRS6131_17430) yuxO 3255660..3256040 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  KJP56_RS17580 (NRS6131_17435) comA 3256059..3256703 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP56_RS17585 (NRS6131_17440) comP 3256784..3259081 (-) 2298 WP_213419241.1 histidine kinase Regulator
  KJP56_RS17590 (NRS6131_17445) comX 3259089..3259250 (-) 162 WP_003241045.1 competence pheromone ComX -
  KJP56_RS17595 (NRS6131_17450) - 3259265..3260125 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  KJP56_RS17600 (NRS6131_17455) degQ 3260310..3260450 (-) 141 WP_213419240.1 degradation enzyme regulation protein DegQ Regulator
  KJP56_RS17605 - 3260672..3260797 (+) 126 WP_154796978.1 hypothetical protein -
  KJP56_RS17610 (NRS6131_17460) - 3260912..3261280 (+) 369 WP_017695529.1 hypothetical protein -
  KJP56_RS17615 (NRS6131_17465) pdeH 3261256..3262485 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP56_RS17620 (NRS6131_17470) pncB 3262622..3264094 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP56_RS17625 (NRS6131_17475) pncA 3264110..3264661 (-) 552 WP_021480500.1 isochorismatase family cysteine hydrolase -
  KJP56_RS17630 (NRS6131_17480) yueI 3264758..3265156 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5531.42 Da        Isoelectric Point: 4.9432

>NTDB_id=1158093 KJP56_RS17600 WP_213419240.1 3260310..3260450(-) (degQ) [Bacillus subtilis isolate NRS6131]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMIIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1158093 KJP56_RS17600 WP_213419240.1 3260310..3260450(-) (degQ) [Bacillus subtilis isolate NRS6131]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGATAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment