Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP60_RS17855 Genome accession   NZ_OX419580
Coordinates   3347703..3347870 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate NRS6116     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3342703..3352870
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP60_RS17825 (NRS6116_17810) mrpE 3343098..3343574 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP60_RS17830 (NRS6116_17815) mrpF 3343574..3343858 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP60_RS17835 (NRS6116_17820) mnhG 3343842..3344216 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP60_RS17840 (NRS6116_17825) yuxO 3344255..3344635 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP60_RS17845 (NRS6116_17830) comA 3344654..3345298 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP60_RS17850 (NRS6116_17835) comP 3345379..3347688 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP60_RS17855 (NRS6116_17840) comX 3347703..3347870 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP60_RS17860 (NRS6116_17845) comQ 3347858..3348757 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP60_RS17865 (NRS6116_17850) degQ 3348942..3349082 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP60_RS17870 - 3349304..3349429 (+) 126 WP_003228793.1 hypothetical protein -
  KJP60_RS17875 (NRS6116_17855) - 3349543..3349911 (+) 369 WP_003243784.1 hypothetical protein -
  KJP60_RS17880 (NRS6116_17860) pdeH 3349887..3351116 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP60_RS17885 (NRS6116_17865) pncB 3351253..3352725 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1158012 KJP60_RS17855 WP_003242801.1 3347703..3347870(-) (comX) [Bacillus subtilis isolate NRS6116]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1158012 KJP60_RS17855 WP_003242801.1 3347703..3347870(-) (comX) [Bacillus subtilis isolate NRS6116]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment