Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP45_RS15705 Genome accession   NZ_OX419578
Coordinates   3040896..3041036 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6128     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3035896..3046036
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP45_RS15680 (NRS6128_15540) yuxO 3036246..3036626 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  KJP45_RS15685 (NRS6128_15545) comA 3036645..3037289 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP45_RS15690 (NRS6128_15550) comP 3037370..3039667 (-) 2298 WP_153912412.1 histidine kinase Regulator
  KJP45_RS15695 (NRS6128_15555) comX 3039675..3039836 (-) 162 WP_049140565.1 competence pheromone ComX -
  KJP45_RS15700 (NRS6128_15560) - 3039851..3040711 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  KJP45_RS15705 (NRS6128_15565) degQ 3040896..3041036 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP45_RS15710 - 3041258..3041383 (+) 126 WP_121549029.1 hypothetical protein -
  KJP45_RS15715 (NRS6128_15570) - 3041497..3041865 (+) 369 WP_213414936.1 hypothetical protein -
  KJP45_RS15720 (NRS6128_15575) pdeH 3041841..3043070 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP45_RS15725 (NRS6128_15580) pncB 3043207..3044679 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP45_RS15730 (NRS6128_15585) pncA 3044695..3045246 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  KJP45_RS15735 (NRS6128_15590) yueI 3045343..3045741 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157850 KJP45_RS15705 WP_003220708.1 3040896..3041036(-) (degQ) [Bacillus subtilis isolate NRS6128]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157850 KJP45_RS15705 WP_003220708.1 3040896..3041036(-) (degQ) [Bacillus subtilis isolate NRS6128]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment