Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP52_RS16360 Genome accession   NZ_OX419575
Coordinates   3143334..3143501 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate NRS6121     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3138334..3148501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP52_RS16330 (NRS6121_16170) mrpE 3138729..3139205 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP52_RS16335 (NRS6121_16175) mrpF 3139205..3139489 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP52_RS16340 (NRS6121_16180) mnhG 3139473..3139847 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP52_RS16345 (NRS6121_16185) yuxO 3139886..3140266 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP52_RS16350 (NRS6121_16190) comA 3140285..3140929 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP52_RS16355 (NRS6121_16195) comP 3141010..3143319 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP52_RS16360 (NRS6121_16200) comX 3143334..3143501 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP52_RS16365 (NRS6121_16205) comQ 3143489..3144388 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP52_RS16370 (NRS6121_16210) degQ 3144573..3144713 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP52_RS16375 - 3144935..3145060 (+) 126 WP_003228793.1 hypothetical protein -
  KJP52_RS16380 (NRS6121_16215) - 3145174..3145542 (+) 369 WP_003243784.1 hypothetical protein -
  KJP52_RS16385 (NRS6121_16220) pdeH 3145518..3146747 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP52_RS16390 (NRS6121_16225) pncB 3146884..3148356 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1157610 KJP52_RS16360 WP_003242801.1 3143334..3143501(-) (comX) [Bacillus subtilis isolate NRS6121]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1157610 KJP52_RS16360 WP_003242801.1 3143334..3143501(-) (comX) [Bacillus subtilis isolate NRS6121]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment