Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP57_RS17945 Genome accession   NZ_OX419573
Coordinates   3372171..3372311 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6085     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3367171..3377311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP57_RS17920 (NRS6085_17895) yuxO 3367485..3367865 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  KJP57_RS17925 (NRS6085_17900) comA 3367884..3368528 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP57_RS17930 (NRS6085_17905) comP 3368609..3370918 (-) 2310 WP_128738181.1 two-component system sensor histidine kinase ComP Regulator
  KJP57_RS17935 (NRS6085_17910) comX 3370933..3371100 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  KJP57_RS17940 (NRS6085_17915) comQ 3371084..3371986 (-) 903 WP_128738182.1 polyprenyl synthetase family protein Regulator
  KJP57_RS17945 (NRS6085_17920) degQ 3372171..3372311 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP57_RS17950 - 3372533..3372658 (+) 126 WP_003228793.1 hypothetical protein -
  KJP57_RS17955 (NRS6085_17925) - 3372772..3373140 (+) 369 WP_116315920.1 hypothetical protein -
  KJP57_RS17960 (NRS6085_17930) pdeH 3373116..3374345 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  KJP57_RS17965 (NRS6085_17935) pncB 3374482..3375954 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP57_RS17970 (NRS6085_17940) pncA 3375970..3376521 (-) 552 WP_213407991.1 isochorismatase family cysteine hydrolase -
  KJP57_RS17975 (NRS6085_17945) yueI 3376618..3377016 (-) 399 WP_128738185.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157527 KJP57_RS17945 WP_003220708.1 3372171..3372311(-) (degQ) [Bacillus subtilis isolate NRS6085]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157527 KJP57_RS17945 WP_003220708.1 3372171..3372311(-) (degQ) [Bacillus subtilis isolate NRS6085]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment