Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP57_RS17935 Genome accession   NZ_OX419573
Coordinates   3370933..3371100 (-) Length   55 a.a.
NCBI ID   WP_100505762.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6085     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3365933..3376100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP57_RS17905 (NRS6085_17880) mrpE 3366328..3366804 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  KJP57_RS17910 (NRS6085_17885) mrpF 3366804..3367088 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP57_RS17915 (NRS6085_17890) mnhG 3367072..3367446 (+) 375 WP_128738180.1 monovalent cation/H(+) antiporter subunit G -
  KJP57_RS17920 (NRS6085_17895) yuxO 3367485..3367865 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  KJP57_RS17925 (NRS6085_17900) comA 3367884..3368528 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP57_RS17930 (NRS6085_17905) comP 3368609..3370918 (-) 2310 WP_128738181.1 two-component system sensor histidine kinase ComP Regulator
  KJP57_RS17935 (NRS6085_17910) comX 3370933..3371100 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  KJP57_RS17940 (NRS6085_17915) comQ 3371084..3371986 (-) 903 WP_128738182.1 polyprenyl synthetase family protein Regulator
  KJP57_RS17945 (NRS6085_17920) degQ 3372171..3372311 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP57_RS17950 - 3372533..3372658 (+) 126 WP_003228793.1 hypothetical protein -
  KJP57_RS17955 (NRS6085_17925) - 3372772..3373140 (+) 369 WP_116315920.1 hypothetical protein -
  KJP57_RS17960 (NRS6085_17930) pdeH 3373116..3374345 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  KJP57_RS17965 (NRS6085_17935) pncB 3374482..3375954 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6505.42 Da        Isoelectric Point: 4.3494

>NTDB_id=1157525 KJP57_RS17935 WP_100505762.1 3370933..3371100(-) (comX) [Bacillus subtilis isolate NRS6085]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYLSGPITREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1157525 KJP57_RS17935 WP_100505762.1 3370933..3371100(-) (comX) [Bacillus subtilis isolate NRS6085]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACAGAAACAATAATTAAAGCTTATAATGATTATTATTTGTCTGGCCCAATAACCCGTGAATGGG
ATGGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.453

96.364

0.891


Multiple sequence alignment