Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP59_RS16740 Genome accession   NZ_OX419570
Coordinates   3200015..3200155 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6134     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3195015..3205155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP59_RS16715 (NRS6134_16605) yuxO 3195328..3195708 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP59_RS16720 (NRS6134_16610) comA 3195727..3196371 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP59_RS16725 (NRS6134_16615) comP 3196452..3198761 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP59_RS16730 (NRS6134_16620) comX 3198776..3198943 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP59_RS16735 (NRS6134_16625) comQ 3198931..3199830 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP59_RS16740 (NRS6134_16630) degQ 3200015..3200155 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP59_RS16745 - 3200377..3200502 (+) 126 WP_003228793.1 hypothetical protein -
  KJP59_RS16750 (NRS6134_16635) - 3200616..3200984 (+) 369 WP_003243784.1 hypothetical protein -
  KJP59_RS16755 (NRS6134_16640) pdeH 3200960..3202189 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP59_RS16760 (NRS6134_16645) pncB 3202326..3203798 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP59_RS16765 (NRS6134_16650) pncA 3203814..3204365 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  KJP59_RS16770 (NRS6134_16655) yueI 3204462..3204860 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157446 KJP59_RS16740 WP_003220708.1 3200015..3200155(-) (degQ) [Bacillus subtilis isolate NRS6134]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157446 KJP59_RS16740 WP_003220708.1 3200015..3200155(-) (degQ) [Bacillus subtilis isolate NRS6134]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment