Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP59_RS12905 Genome accession   NZ_OX419570
Coordinates   2499432..2499815 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6134     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2494432..2504815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP59_RS12865 (NRS6134_12815) sinI 2495366..2495539 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP59_RS12870 (NRS6134_12820) sinR 2495573..2495908 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP59_RS12875 (NRS6134_12825) tasA 2496001..2496786 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP59_RS12880 (NRS6134_12830) sipW 2496850..2497422 (-) 573 WP_003230181.1 signal peptidase I -
  KJP59_RS12885 (NRS6134_12835) tapA 2497406..2498167 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  KJP59_RS12890 (NRS6134_12840) yqzG 2498439..2498765 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP59_RS12895 (NRS6134_12845) spoIIT 2498807..2498986 (-) 180 WP_003230176.1 YqzE family protein -
  KJP59_RS12900 (NRS6134_12850) comGG 2499057..2499431 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP59_RS12905 (NRS6134_12855) comGF 2499432..2499815 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP59_RS12910 (NRS6134_12860) comGE 2499841..2500188 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP59_RS12915 (NRS6134_12865) comGD 2500172..2500603 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  KJP59_RS12920 (NRS6134_12870) comGC 2500593..2500889 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP59_RS12925 (NRS6134_12875) comGB 2500903..2501940 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  KJP59_RS12930 (NRS6134_12880) comGA 2501927..2502997 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP59_RS12935 (NRS6134_12890) corA 2503409..2504362 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1157423 KJP59_RS12905 WP_003230168.1 2499432..2499815(-) (comGF) [Bacillus subtilis isolate NRS6134]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1157423 KJP59_RS12905 WP_003230168.1 2499432..2499815(-) (comGF) [Bacillus subtilis isolate NRS6134]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment