Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP55_RS17500 Genome accession   NZ_OX419569
Coordinates   3302409..3302549 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6118     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3297409..3307549
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP55_RS17475 (NRS6118_17335) yuxO 3297722..3298102 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP55_RS17480 (NRS6118_17340) comA 3298121..3298765 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP55_RS17485 (NRS6118_17345) comP 3298846..3301155 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP55_RS17490 (NRS6118_17350) comX 3301170..3301337 (-) 168 WP_153932906.1 competence pheromone ComX Regulator
  KJP55_RS17495 (NRS6118_17355) comQ 3301325..3302224 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP55_RS17500 (NRS6118_17360) degQ 3302409..3302549 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP55_RS17505 - 3302771..3302896 (+) 126 WP_003228793.1 hypothetical protein -
  KJP55_RS17510 (NRS6118_17365) - 3303010..3303378 (+) 369 WP_003243784.1 hypothetical protein -
  KJP55_RS17515 (NRS6118_17370) pdeH 3303354..3304583 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP55_RS17520 (NRS6118_17375) pncB 3304720..3306192 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP55_RS17525 (NRS6118_17380) pncA 3306208..3306759 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  KJP55_RS17530 (NRS6118_17385) yueI 3306856..3307254 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157360 KJP55_RS17500 WP_003220708.1 3302409..3302549(-) (degQ) [Bacillus subtilis isolate NRS6118]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157360 KJP55_RS17500 WP_003220708.1 3302409..3302549(-) (degQ) [Bacillus subtilis isolate NRS6118]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment