Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP55_RS17490 Genome accession   NZ_OX419569
Coordinates   3301170..3301337 (-) Length   55 a.a.
NCBI ID   WP_153932906.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6118     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3296170..3306337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP55_RS17460 (NRS6118_17320) mrpE 3296565..3297041 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP55_RS17465 (NRS6118_17325) mrpF 3297041..3297325 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP55_RS17470 (NRS6118_17330) mnhG 3297309..3297683 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP55_RS17475 (NRS6118_17335) yuxO 3297722..3298102 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP55_RS17480 (NRS6118_17340) comA 3298121..3298765 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP55_RS17485 (NRS6118_17345) comP 3298846..3301155 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP55_RS17490 (NRS6118_17350) comX 3301170..3301337 (-) 168 WP_153932906.1 competence pheromone ComX Regulator
  KJP55_RS17495 (NRS6118_17355) comQ 3301325..3302224 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP55_RS17500 (NRS6118_17360) degQ 3302409..3302549 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP55_RS17505 - 3302771..3302896 (+) 126 WP_003228793.1 hypothetical protein -
  KJP55_RS17510 (NRS6118_17365) - 3303010..3303378 (+) 369 WP_003243784.1 hypothetical protein -
  KJP55_RS17515 (NRS6118_17370) pdeH 3303354..3304583 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP55_RS17520 (NRS6118_17375) pncB 3304720..3306192 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6492.38 Da        Isoelectric Point: 4.5636

>NTDB_id=1157358 KJP55_RS17490 WP_153932906.1 3301170..3301337(-) (comX) [Bacillus subtilis isolate NRS6118]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAHNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1157358 KJP55_RS17490 WP_153932906.1 3301170..3301337(-) (comX) [Bacillus subtilis isolate NRS6118]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTCATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

98.182

100

0.982


Multiple sequence alignment