Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP55_RS13615 Genome accession   NZ_OX419569
Coordinates   2597759..2597932 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6118     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2592759..2602932
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP55_RS13600 (NRS6118_13535) gcvT 2593558..2594646 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP55_RS13605 (NRS6118_13540) yqhH 2595088..2596761 (+) 1674 WP_004398544.1 SNF2-related protein -
  KJP55_RS13610 (NRS6118_13545) yqhG 2596782..2597576 (+) 795 WP_003230200.1 YqhG family protein -
  KJP55_RS13615 (NRS6118_13550) sinI 2597759..2597932 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP55_RS13620 (NRS6118_13555) sinR 2597966..2598301 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP55_RS13625 (NRS6118_13560) tasA 2598394..2599179 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP55_RS13630 (NRS6118_13565) sipW 2599243..2599815 (-) 573 WP_003246088.1 signal peptidase I -
  KJP55_RS13635 (NRS6118_13570) tapA 2599799..2600560 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  KJP55_RS13640 (NRS6118_13575) yqzG 2600832..2601158 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP55_RS13645 (NRS6118_13580) spoIIT 2601200..2601379 (-) 180 WP_003230176.1 YqzE family protein -
  KJP55_RS13650 (NRS6118_13585) comGG 2601450..2601824 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP55_RS13655 (NRS6118_13590) comGF 2601825..2602208 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP55_RS13660 (NRS6118_13595) comGE 2602234..2602581 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157334 KJP55_RS13615 WP_003230187.1 2597759..2597932(+) (sinI) [Bacillus subtilis isolate NRS6118]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157334 KJP55_RS13615 WP_003230187.1 2597759..2597932(+) (sinI) [Bacillus subtilis isolate NRS6118]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment