Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP55_RS13655 Genome accession   NZ_OX419569
Coordinates   2601825..2602208 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6118     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2596825..2607208
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP55_RS13615 (NRS6118_13550) sinI 2597759..2597932 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP55_RS13620 (NRS6118_13555) sinR 2597966..2598301 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP55_RS13625 (NRS6118_13560) tasA 2598394..2599179 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP55_RS13630 (NRS6118_13565) sipW 2599243..2599815 (-) 573 WP_003246088.1 signal peptidase I -
  KJP55_RS13635 (NRS6118_13570) tapA 2599799..2600560 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  KJP55_RS13640 (NRS6118_13575) yqzG 2600832..2601158 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP55_RS13645 (NRS6118_13580) spoIIT 2601200..2601379 (-) 180 WP_003230176.1 YqzE family protein -
  KJP55_RS13650 (NRS6118_13585) comGG 2601450..2601824 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP55_RS13655 (NRS6118_13590) comGF 2601825..2602208 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP55_RS13660 (NRS6118_13595) comGE 2602234..2602581 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP55_RS13665 (NRS6118_13600) comGD 2602565..2602996 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  KJP55_RS13670 (NRS6118_13605) comGC 2602986..2603282 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP55_RS13675 (NRS6118_13610) comGB 2603296..2604333 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  KJP55_RS13680 (NRS6118_13615) comGA 2604320..2605390 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP55_RS13685 (NRS6118_13625) corA 2605802..2606755 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1157337 KJP55_RS13655 WP_003230168.1 2601825..2602208(-) (comGF) [Bacillus subtilis isolate NRS6118]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1157337 KJP55_RS13655 WP_003230168.1 2601825..2602208(-) (comGF) [Bacillus subtilis isolate NRS6118]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment