Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP48_RS13365 Genome accession   NZ_OX419564
Coordinates   2547834..2548217 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6127     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2542834..2553217
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP48_RS13325 (NRS6127_13240) sinI 2543767..2543940 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP48_RS13330 (NRS6127_13245) sinR 2543974..2544309 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP48_RS13335 (NRS6127_13250) tasA 2544402..2545187 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP48_RS13340 (NRS6127_13255) sipW 2545251..2545823 (-) 573 WP_072692741.1 signal peptidase I -
  KJP48_RS13345 (NRS6127_13260) tapA 2545807..2546568 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP48_RS13350 (NRS6127_13265) yqzG 2546840..2547166 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP48_RS13355 (NRS6127_13270) spoIIT 2547208..2547387 (-) 180 WP_029726723.1 YqzE family protein -
  KJP48_RS13360 (NRS6127_13275) comGG 2547459..2547833 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP48_RS13365 comGF 2547834..2548217 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP48_RS13370 (NRS6127_13285) comGE 2548243..2548590 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP48_RS13375 (NRS6127_13290) comGD 2548574..2549005 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP48_RS13380 (NRS6127_13295) comGC 2548995..2549291 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP48_RS13385 (NRS6127_13300) comGB 2549305..2550342 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP48_RS13390 (NRS6127_13305) comGA 2550329..2551399 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP48_RS13395 (NRS6127_13315) - 2551612..2551809 (-) 198 WP_029726717.1 hypothetical protein -
  KJP48_RS13400 (NRS6127_13320) corA 2551811..2552764 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=1157083 KJP48_RS13365 WP_029726721.1 2547834..2548217(-) (comGF) [Bacillus subtilis isolate NRS6127]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1157083 KJP48_RS13365 WP_029726721.1 2547834..2548217(-) (comGF) [Bacillus subtilis isolate NRS6127]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment