Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJP75_RS12440 Genome accession   NZ_OX419560
Coordinates   2421035..2421409 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6132     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2416035..2426409
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP75_RS12400 (NRS6132_12310) yqhG 2416366..2417160 (+) 795 WP_015714249.1 YqhG family protein -
  KJP75_RS12405 (NRS6132_12315) sinI 2417343..2417516 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP75_RS12410 (NRS6132_12320) sinR 2417550..2417885 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP75_RS12415 (NRS6132_12325) tasA 2417978..2418763 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP75_RS12420 (NRS6132_12330) sipW 2418827..2419399 (-) 573 WP_072692741.1 signal peptidase I -
  KJP75_RS12425 (NRS6132_12335) tapA 2419383..2420144 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP75_RS12430 (NRS6132_12340) yqzG 2420416..2420742 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP75_RS12435 (NRS6132_12345) spoIIT 2420784..2420963 (-) 180 WP_029726723.1 YqzE family protein -
  KJP75_RS12440 (NRS6132_12350) comGG 2421035..2421409 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP75_RS12445 (NRS6132_12355) comGF 2421410..2421793 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP75_RS12450 (NRS6132_12360) comGE 2421819..2422166 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP75_RS12455 (NRS6132_12365) comGD 2422150..2422581 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP75_RS12460 (NRS6132_12370) comGC 2422571..2422867 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP75_RS12465 (NRS6132_12375) comGB 2422881..2423918 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP75_RS12470 (NRS6132_12380) comGA 2423905..2424975 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP75_RS12475 (NRS6132_12390) - 2425188..2425385 (-) 198 WP_029726717.1 hypothetical protein -
  KJP75_RS12480 (NRS6132_12395) corA 2425387..2426340 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=1156917 KJP75_RS12440 WP_029726722.1 2421035..2421409(-) (comGG) [Bacillus subtilis isolate NRS6132]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1156917 KJP75_RS12440 WP_029726722.1 2421035..2421409(-) (comGG) [Bacillus subtilis isolate NRS6132]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment