Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP75_RS12405 Genome accession   NZ_OX419560
Coordinates   2417343..2417516 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6132     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2412343..2422516
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP75_RS12390 (NRS6132_12300) gcvT 2413143..2414231 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP75_RS12395 (NRS6132_12305) yqhH 2414672..2416345 (+) 1674 WP_029726726.1 SNF2-related protein -
  KJP75_RS12400 (NRS6132_12310) yqhG 2416366..2417160 (+) 795 WP_015714249.1 YqhG family protein -
  KJP75_RS12405 (NRS6132_12315) sinI 2417343..2417516 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP75_RS12410 (NRS6132_12320) sinR 2417550..2417885 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP75_RS12415 (NRS6132_12325) tasA 2417978..2418763 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP75_RS12420 (NRS6132_12330) sipW 2418827..2419399 (-) 573 WP_072692741.1 signal peptidase I -
  KJP75_RS12425 (NRS6132_12335) tapA 2419383..2420144 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP75_RS12430 (NRS6132_12340) yqzG 2420416..2420742 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP75_RS12435 (NRS6132_12345) spoIIT 2420784..2420963 (-) 180 WP_029726723.1 YqzE family protein -
  KJP75_RS12440 (NRS6132_12350) comGG 2421035..2421409 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP75_RS12445 (NRS6132_12355) comGF 2421410..2421793 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP75_RS12450 (NRS6132_12360) comGE 2421819..2422166 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1156915 KJP75_RS12405 WP_003230187.1 2417343..2417516(+) (sinI) [Bacillus subtilis isolate NRS6132]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1156915 KJP75_RS12405 WP_003230187.1 2417343..2417516(+) (sinI) [Bacillus subtilis isolate NRS6132]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment