Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KJP68_RS12430 Genome accession   NZ_OX419559
Coordinates   2419444..2419818 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6099     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2414444..2424818
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP68_RS12390 (NRS6099_12310) yqhG 2414775..2415569 (+) 795 WP_015714249.1 YqhG family protein -
  KJP68_RS12395 (NRS6099_12315) sinI 2415752..2415925 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP68_RS12400 (NRS6099_12320) sinR 2415959..2416294 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP68_RS12405 (NRS6099_12325) tasA 2416387..2417172 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP68_RS12410 (NRS6099_12330) sipW 2417236..2417808 (-) 573 WP_072692741.1 signal peptidase I -
  KJP68_RS12415 (NRS6099_12335) tapA 2417792..2418553 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP68_RS12420 (NRS6099_12340) yqzG 2418825..2419151 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP68_RS12425 (NRS6099_12345) spoIIT 2419193..2419372 (-) 180 WP_029726723.1 YqzE family protein -
  KJP68_RS12430 (NRS6099_12350) comGG 2419444..2419818 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP68_RS12435 comGF 2419819..2420202 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP68_RS12440 (NRS6099_12360) comGE 2420228..2420575 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP68_RS12445 (NRS6099_12365) comGD 2420559..2420990 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP68_RS12450 (NRS6099_12370) comGC 2420980..2421276 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP68_RS12455 (NRS6099_12375) comGB 2421290..2422327 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP68_RS12460 (NRS6099_12380) comGA 2422314..2423384 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP68_RS12465 (NRS6099_12390) - 2423597..2423794 (-) 198 WP_029726717.1 hypothetical protein -
  KJP68_RS12470 (NRS6099_12395) corA 2423796..2424749 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=1156838 KJP68_RS12430 WP_029726722.1 2419444..2419818(-) (comGG) [Bacillus subtilis isolate NRS6099]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1156838 KJP68_RS12430 WP_029726722.1 2419444..2419818(-) (comGG) [Bacillus subtilis isolate NRS6099]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952


Multiple sequence alignment