Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP77_RS17300 Genome accession   NZ_OX419554
Coordinates   3269045..3269185 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6160     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3264045..3274185
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP77_RS17275 (NRS6160_17080) yuxO 3264322..3264702 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  KJP77_RS17280 (NRS6160_17085) comA 3264721..3265365 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP77_RS17285 (NRS6160_17090) comP 3265446..3267758 (-) 2313 WP_069703660.1 histidine kinase Regulator
  KJP77_RS17290 (NRS6160_17095) comX 3267774..3267995 (-) 222 WP_014480704.1 competence pheromone ComX -
  KJP77_RS17295 (NRS6160_17100) - 3267997..3268860 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  KJP77_RS17300 (NRS6160_17105) degQ 3269045..3269185 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP77_RS17305 - 3269407..3269532 (+) 126 WP_003228793.1 hypothetical protein -
  KJP77_RS17310 (NRS6160_17110) - 3269646..3270014 (+) 369 WP_014477834.1 hypothetical protein -
  KJP77_RS17315 (NRS6160_17115) pdeH 3269990..3271219 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  KJP77_RS17320 (NRS6160_17120) pncB 3271356..3272828 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP77_RS17325 (NRS6160_17125) pncA 3272844..3273395 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  KJP77_RS17330 (NRS6160_17130) yueI 3273492..3273890 (-) 399 WP_088467369.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1156623 KJP77_RS17300 WP_003220708.1 3269045..3269185(-) (degQ) [Bacillus subtilis isolate NRS6160]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1156623 KJP77_RS17300 WP_003220708.1 3269045..3269185(-) (degQ) [Bacillus subtilis isolate NRS6160]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment