Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAMY6614_RS17885 Genome accession   NZ_CP006960
Coordinates   3732362..3732502 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens UMAF6614     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3727362..3737502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6614_RS17860 (BAMY6614_18890) - 3727658..3728041 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BAMY6614_RS17865 (BAMY6614_18895) comA 3728063..3728707 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAMY6614_RS17870 (BAMY6614_18900) comP 3728788..3731097 (-) 2310 WP_061862531.1 sensor histidine kinase Regulator
  BAMY6614_RS17875 (BAMY6614_18905) - 3731117..3731293 (-) 177 WP_007408675.1 competence pheromone ComX -
  BAMY6614_RS17880 (BAMY6614_18910) comQ 3731293..3732231 (-) 939 WP_269465507.1 polyprenyl synthetase family protein Regulator
  BAMY6614_RS17885 (BAMY6614_18915) degQ 3732362..3732502 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAMY6614_RS17890 (BAMY6614_18920) - 3732968..3733309 (+) 342 WP_061862532.1 hypothetical protein -
  BAMY6614_RS17895 (BAMY6614_18925) - 3733316..3734539 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BAMY6614_RS17900 (BAMY6614_18930) - 3734669..3736135 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  BAMY6614_RS17905 (BAMY6614_18935) - 3736153..3736704 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAMY6614_RS17910 (BAMY6614_18940) - 3736801..3737199 (-) 399 WP_061862533.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=115359 BAMY6614_RS17885 WP_003152043.1 3732362..3732502(-) (degQ) [Bacillus amyloliquefaciens UMAF6614]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=115359 BAMY6614_RS17885 WP_003152043.1 3732362..3732502(-) (degQ) [Bacillus amyloliquefaciens UMAF6614]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAATAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment