Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   BAMY6614_RS14985 Genome accession   NZ_CP006960
Coordinates   3168777..3169043 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens UMAF6614     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3163777..3174043
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6614_RS14935 (BAMY6614_15780) sinR 3163940..3164275 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAMY6614_RS14940 (BAMY6614_15785) tasA 3164323..3165108 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAMY6614_RS14945 (BAMY6614_15790) sipW 3165173..3165757 (-) 585 WP_014418370.1 signal peptidase I SipW -
  BAMY6614_RS14950 (BAMY6614_15795) tapA 3165729..3166400 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAMY6614_RS14955 (BAMY6614_15800) - 3166659..3166988 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAMY6614_RS14960 (BAMY6614_15805) - 3167029..3167208 (-) 180 WP_003153093.1 YqzE family protein -
  BAMY6614_RS14965 (BAMY6614_15810) comGG 3167265..3167642 (-) 378 WP_061862389.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMY6614_RS14970 (BAMY6614_15815) comGF 3167643..3168038 (-) 396 WP_061862390.1 competence type IV pilus minor pilin ComGF -
  BAMY6614_RS14975 (BAMY6614_15820) comGE 3168052..3168366 (-) 315 WP_061862391.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMY6614_RS14980 (BAMY6614_15825) comGD 3168350..3168787 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAMY6614_RS14985 (BAMY6614_15830) comGC 3168777..3169043 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BAMY6614_RS14990 (BAMY6614_15835) comGB 3169090..3170127 (-) 1038 WP_061862392.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAMY6614_RS14995 (BAMY6614_15840) comGA 3170114..3171184 (-) 1071 WP_061862635.1 competence type IV pilus ATPase ComGA Machinery gene
  BAMY6614_RS15000 (BAMY6614_15845) - 3171377..3172327 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  BAMY6614_RS15005 (BAMY6614_15850) - 3172473..3173774 (+) 1302 WP_061862393.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=115341 BAMY6614_RS14985 WP_050496152.1 3168777..3169043(-) (comGC) [Bacillus amyloliquefaciens UMAF6614]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=115341 BAMY6614_RS14985 WP_050496152.1 3168777..3169043(-) (comGC) [Bacillus amyloliquefaciens UMAF6614]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602

Multiple sequence alignment