Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   KG893_RS09510 Genome accession   NZ_OD940440
Coordinates   1919262..1919789 (-) Length   175 a.a.
NCBI ID   WP_002381634.1    Uniprot ID   -
Organism   Enterococcus faecalis isolate WE0254     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1885772..1929777 1919262..1919789 within 0


Gene organization within MGE regions


Location: 1885772..1929777
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KG893_RS09275 (WE0254_01899) - 1885772..1886215 (+) 444 WP_002356885.1 flavodoxin -
  KG893_RS09280 (WE0254_01900) - 1886290..1886763 (-) 474 WP_002356884.1 TspO/MBR family protein -
  KG893_RS09285 (WE0254_01901) - 1886921..1887493 (-) 573 WP_002356883.1 TetR/AcrR family transcriptional regulator -
  KG893_RS09290 (WE0254_01902) - 1887744..1888982 (+) 1239 WP_002362125.1 aminopeptidase -
  KG893_RS09295 (WE0254_01903) - 1889242..1889622 (+) 381 WP_002381671.1 PH domain-containing protein -
  KG893_RS09300 (WE0254_01904) - 1889994..1890575 (+) 582 WP_002381670.1 DUF4950 domain-containing protein -
  KG893_RS09305 (WE0254_01905) - 1890952..1892454 (+) 1503 WP_002381669.1 glucosyltransferase domain-containing protein -
  KG893_RS09310 (WE0254_01906) - 1892518..1893783 (-) 1266 WP_010783581.1 peptidoglycan DD-metalloendopeptidase family protein -
  KG893_RS14895 (WE0254_01907) - 1893872..1894102 (-) 231 WP_260411992.1 hypothetical protein -
  KG893_RS09320 (WE0254_01908) - 1894265..1895524 (-) 1260 WP_002381667.1 LysM peptidoglycan-binding domain-containing protein -
  KG893_RS09325 (WE0254_01909) - 1895530..1895733 (-) 204 WP_002381666.1 phage holin -
  KG893_RS09330 (WE0254_01910) - 1895730..1895957 (-) 228 WP_002381665.1 hypothetical protein -
  KG893_RS09335 (WE0254_01911) - 1896031..1897794 (-) 1764 WP_002381664.1 hypothetical protein -
  KG893_RS09340 (WE0254_01912) - 1897805..1897978 (-) 174 WP_002369077.1 hypothetical protein -
  KG893_RS09345 (WE0254_01913) - 1897979..1899997 (-) 2019 WP_002398582.1 phage tail protein -
  KG893_RS09350 (WE0254_01914) - 1900014..1900943 (-) 930 WP_002373078.1 distal tail protein Dit -
  KG893_RS09355 (WE0254_01915) - 1900944..1904351 (-) 3408 WP_002398581.1 tape measure protein -
  KG893_RS09360 (WE0254_01916) - 1904367..1904624 (-) 258 WP_002381661.1 hypothetical protein -
  KG893_RS09365 (WE0254_01917) - 1904717..1905067 (-) 351 WP_002398580.1 tail assembly chaperone -
  KG893_RS09370 (WE0254_01918) - 1905123..1905581 (-) 459 WP_002398579.1 hypothetical protein -
  KG893_RS09375 (WE0254_01919) - 1905659..1906189 (-) 531 WP_002381658.1 phage major tail protein, TP901-1 family -
  KG893_RS09380 (WE0254_01920) - 1906205..1906594 (-) 390 WP_002381657.1 hypothetical protein -
  KG893_RS09385 (WE0254_01921) - 1906591..1906971 (-) 381 WP_002373070.1 HK97-gp10 family putative phage morphogenesis protein -
  KG893_RS09390 (WE0254_01922) - 1906946..1907281 (-) 336 WP_002381656.1 hypothetical protein -
  KG893_RS09395 (WE0254_01923) - 1907278..1907610 (-) 333 WP_002373068.1 phage head-tail connector protein -
  KG893_RS09400 (WE0254_01924) - 1907684..1908616 (-) 933 WP_002381655.1 phage major capsid protein -
  KG893_RS09405 (WE0254_01925) - 1908629..1909228 (-) 600 WP_002373065.1 DUF4355 domain-containing protein -
  KG893_RS09410 (WE0254_01926) - 1909423..1909644 (-) 222 WP_002381654.1 hypothetical protein -
  KG893_RS09415 (WE0254_01927) - 1909641..1909910 (-) 270 WP_002381653.1 hypothetical protein -
  KG893_RS09420 (WE0254_01928) - 1909911..1910849 (-) 939 WP_002381652.1 minor capsid protein -
  KG893_RS09425 (WE0254_01929) - 1910854..1912392 (-) 1539 WP_002381651.1 phage portal protein -
  KG893_RS09430 (WE0254_01930) - 1912406..1913800 (-) 1395 WP_002398577.1 terminase large subunit domain-containing protein -
  KG893_RS09435 (WE0254_01931) - 1913787..1914260 (-) 474 WP_002398576.1 terminase small subunit -
  KG893_RS09440 (WE0254_01932) - 1914328..1914972 (-) 645 WP_002381648.1 hypothetical protein -
  KG893_RS09445 (WE0254_01933) - 1915222..1915629 (-) 408 WP_002381647.1 transcriptional regulator -
  KG893_RS09450 (WE0254_01934) - 1915630..1915821 (-) 192 WP_002381645.1 hypothetical protein -
  KG893_RS09455 (WE0254_01935) - 1915825..1916025 (-) 201 WP_002398575.1 hypothetical protein -
  KG893_RS09460 (WE0254_01936) - 1916026..1916577 (-) 552 WP_010783583.1 DUF1642 domain-containing protein -
  KG893_RS09465 (WE0254_01937) - 1916580..1916819 (-) 240 WP_002381642.1 hypothetical protein -
  KG893_RS09470 (WE0254_01939) - 1917028..1917195 (-) 168 WP_002398574.1 hypothetical protein -
  KG893_RS09475 (WE0254_01940) - 1917192..1917515 (-) 324 WP_002381640.1 hypothetical protein -
  KG893_RS09480 (WE0254_01941) - 1917512..1917745 (-) 234 WP_002381639.1 hypothetical protein -
  KG893_RS09485 (WE0254_01942) - 1917742..1918077 (-) 336 WP_002381638.1 hypothetical protein -
  KG893_RS09490 (WE0254_01943) - 1918078..1918509 (-) 432 WP_002398573.1 YopX family protein -
  KG893_RS09495 (WE0254_01944) - 1918493..1918672 (-) 180 WP_010712230.1 hypothetical protein -
  KG893_RS09500 (WE0254_01945) - 1918694..1918900 (-) 207 WP_002381636.1 hypothetical protein -
  KG893_RS09505 (WE0254_01946) - 1918920..1919249 (-) 330 WP_002381635.1 hypothetical protein -
  KG893_RS09510 (WE0254_01947) ssb 1919262..1919789 (-) 528 WP_002381634.1 single-stranded DNA-binding protein Machinery gene
  KG893_RS09515 (WE0254_01948) - 1919779..1920087 (-) 309 WP_002381633.1 MazG-like family protein -
  KG893_RS09520 (WE0254_01949) - 1920087..1920893 (-) 807 WP_002381632.1 helix-turn-helix domain-containing protein -
  KG893_RS09525 (WE0254_01950) - 1920897..1921538 (-) 642 WP_002381630.1 putative HNHc nuclease -
  KG893_RS09530 (WE0254_01951) - 1921543..1922559 (-) 1017 WP_002381629.1 AAA family ATPase -
  KG893_RS09535 (WE0254_01952) - 1922571..1923050 (-) 480 WP_002381628.1 siphovirus Gp157 family protein -
  KG893_RS14900 (WE0254_01953) - 1923034..1923156 (-) 123 WP_002364322.1 hypothetical protein -
  KG893_RS09540 (WE0254_01955) - 1923242..1923544 (-) 303 WP_002381627.1 hypothetical protein -
  KG893_RS09545 (WE0254_01957) - 1923652..1923825 (-) 174 WP_002381626.1 hypothetical protein -
  KG893_RS09550 (WE0254_01958) - 1923837..1924022 (-) 186 WP_002381625.1 hypothetical protein -
  KG893_RS09555 (WE0254_01960) - 1924258..1924434 (+) 177 WP_224806036.1 KTSC domain-containing protein -
  KG893_RS09560 (WE0254_01961) - 1924435..1924593 (-) 159 WP_002381624.1 hypothetical protein -
  KG893_RS09565 (WE0254_01962) - 1924607..1924903 (-) 297 WP_002381623.1 hypothetical protein -
  KG893_RS09570 (WE0254_01963) - 1924905..1925657 (-) 753 WP_002381621.1 Rha family transcriptional regulator -
  KG893_RS09575 (WE0254_01964) - 1925677..1925928 (-) 252 WP_002381619.1 hypothetical protein -
  KG893_RS09580 (WE0254_01965) - 1925967..1926230 (-) 264 WP_002369031.1 helix-turn-helix transcriptional regulator -
  KG893_RS09585 (WE0254_01966) - 1926369..1926893 (+) 525 WP_002381618.1 helix-turn-helix domain-containing protein -
  KG893_RS09590 (WE0254_01967) - 1926868..1927383 (+) 516 WP_079999058.1 ImmA/IrrE family metallo-endopeptidase -
  KG893_RS09595 (WE0254_01968) - 1927473..1928357 (+) 885 WP_002381616.1 Ltp family lipoprotein -
  KG893_RS09600 (WE0254_01969) - 1928373..1928573 (+) 201 WP_002389940.1 hypothetical protein -
  KG893_RS09605 (WE0254_01970) - 1928641..1929777 (+) 1137 WP_002381615.1 site-specific integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19447.25 Da        Isoelectric Point: 4.4762

>NTDB_id=1150768 KG893_RS09510 WP_002381634.1 1919262..1919789(-) (ssb) [Enterococcus faecalis isolate WE0254]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSIQTSQNDGTSVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
DAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=1150768 KG893_RS09510 WP_002381634.1 1919262..1919789(-) (ssb) [Enterococcus faecalis isolate WE0254]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAATTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAAAGTTTCCAATTATTAGAGTCAAAAAG
TACCAATGAAAATAGAAATAGCATCCAGACGTCACAGAATGACGGTACAAGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTGGATCCGTTCGCA
GATGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.674

100

0.617
  ssbA Bacillus subtilis subsp. subtilis str. 168

56

100

0.56

Multiple sequence alignment