Detailed information    

insolico Bioinformatically predicted

Overview


Name   comEA   Type   Machinery gene
Locus tag   DXE62_RS00695 Genome accession   NZ_LT992465
Coordinates   108008..108694 (+) Length   228 a.a.
NCBI ID   WP_001825349.1    Uniprot ID   -
Organism   Staphylococcus aureus isolate 6_LA_232     
Function   dsDNA binding to the cell surface (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 53712..112484 108008..108694 within 0


Gene organization within MGE regions


Location: 53712..112484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXE62_RS00300 - 53712..54434 (+) 723 Protein_57 Fic family protein -
  DXE62_RS00305 - 54530..55735 (-) 1206 WP_000264184.1 tyrosine-type recombinase/integrase -
  DXE62_RS00310 - 55845..56459 (+) 615 WP_000191461.1 hypothetical protein -
  DXE62_RS00315 - 56456..56602 (-) 147 WP_001013104.1 hypothetical protein -
  DXE62_RS00320 - 56832..57416 (-) 585 WP_000825948.1 hypothetical protein -
  DXE62_RS00325 - 57434..57895 (-) 462 WP_000525004.1 hypothetical protein -
  DXE62_RS00330 - 57908..58231 (-) 324 WP_114637613.1 helix-turn-helix domain-containing protein -
  DXE62_RS00335 - 58395..58643 (+) 249 WP_000272859.1 helix-turn-helix domain-containing protein -
  DXE62_RS00340 - 58656..59099 (+) 444 WP_000435362.1 hypothetical protein -
  DXE62_RS14715 - 59114..59263 (+) 150 WP_000771849.1 hypothetical protein -
  DXE62_RS00345 - 59304..59516 (-) 213 WP_000362644.1 hypothetical protein -
  DXE62_RS00350 - 59587..59730 (+) 144 WP_000939498.1 hypothetical protein -
  DXE62_RS00355 - 59720..59929 (-) 210 WP_000642492.1 hypothetical protein -
  DXE62_RS00360 - 59985..60230 (+) 246 WP_001025401.1 DUF2829 domain-containing protein -
  DXE62_RS00365 - 60199..60564 (-) 366 WP_001128433.1 hypothetical protein -
  DXE62_RS00370 - 60619..60835 (+) 217 Protein_72 hypothetical protein -
  DXE62_RS00375 - 60862..61125 (+) 264 WP_001124195.1 helix-turn-helix domain-containing protein -
  DXE62_RS00380 - 61137..61298 (+) 162 WP_001285949.1 DUF1270 domain-containing protein -
  DXE62_RS00385 - 61377..61700 (+) 324 WP_000174994.1 hypothetical protein -
  DXE62_RS00390 - 61715..62077 (+) 363 WP_031775157.1 hypothetical protein -
  DXE62_RS00395 - 62074..63240 (+) 1167 WP_031795549.1 DUF2800 domain-containing protein -
  DXE62_RS00400 - 63266..63823 (+) 558 WP_000645042.1 DUF2815 family protein -
  DXE62_RS00405 - 63892..65844 (+) 1953 WP_078098872.1 DNA polymerase -
  DXE62_RS00410 - 65857..66041 (+) 185 Protein_80 DUF3113 family protein -
  DXE62_RS00415 - 66041..66442 (+) 402 WP_000113974.1 SA1788 family PVL leukocidin-associated protein -
  DXE62_RS00420 - 66442..66696 (+) 255 WP_000022727.1 DUF3310 domain-containing protein -
  DXE62_RS00425 - 66696..66944 (+) 249 WP_001802342.1 SAV1978 family virulence-associated passenger protein -
  DXE62_RS00430 - 66958..67164 (+) 207 WP_000693989.1 hypothetical protein -
  DXE62_RS00435 - 67167..67574 (+) 408 WP_000695771.1 hypothetical protein -
  DXE62_RS00440 - 67571..67765 (+) 195 WP_000983950.1 hypothetical protein -
  DXE62_RS00445 - 67762..68199 (+) 438 WP_000982714.1 YopX family protein -
  DXE62_RS00450 - 68196..68561 (+) 366 WP_001105602.1 hypothetical protein -
  DXE62_RS00455 - 68554..68802 (+) 249 WP_031795590.1 DUF1024 family protein -
  DXE62_RS00460 - 68795..69331 (+) 537 WP_000185680.1 dUTPase -
  DXE62_RS00465 - 69368..69574 (+) 207 WP_031795553.1 DUF1381 domain-containing protein -
  DXE62_RS00470 rinB 69571..69723 (+) 153 WP_000595213.1 transcriptional activator RinB -
  DXE62_RS00475 - 69791..69991 (+) 201 WP_031794940.1 DUF1514 family protein -
  DXE62_RS00480 - 70043..72490 (+) 2448 WP_031795554.1 virulence-associated E family protein -
  DXE62_RS00485 - 72593..72697 (-) 105 WP_011447017.1 hypothetical protein -
  DXE62_RS00490 - 72831..73121 (+) 291 WP_000665203.1 VRR-NUC domain-containing protein -
  DXE62_RS00495 - 73102..74469 (+) 1368 WP_078098871.1 SNF2-related protein -
  DXE62_RS00500 - 74482..74919 (+) 438 WP_031795556.1 transcriptional regulator -
  DXE62_RS00505 - 75076..75390 (+) 315 WP_031775147.1 HNH endonuclease -
  DXE62_RS00510 - 75518..75823 (+) 306 WP_000778933.1 P27 family phage terminase small subunit -
  DXE62_RS00515 - 75813..77504 (+) 1692 WP_000153538.1 terminase large subunit -
  DXE62_RS00520 - 77509..78747 (+) 1239 WP_001100659.1 phage portal protein -
  DXE62_RS00525 - 78731..79504 (+) 774 WP_000061862.1 head maturation protease, ClpP-related -
  DXE62_RS00530 - 79516..80679 (+) 1164 WP_001142738.1 phage major capsid protein -
  DXE62_RS00535 - 80748..81026 (+) 279 WP_000050973.1 head-tail connector protein -
  DXE62_RS00540 - 81038..81370 (+) 333 WP_000395498.1 hypothetical protein -
  DXE62_RS00545 - 81367..81768 (+) 402 WP_000110017.1 hypothetical protein -
  DXE62_RS00550 - 81769..82164 (+) 396 WP_031863976.1 DUF3168 domain-containing protein -
  DXE62_RS00555 - 82199..82840 (+) 642 WP_031865961.1 major tail protein -
  DXE62_RS00560 - 82931..83386 (+) 456 WP_000169128.1 Ig-like domain-containing protein -
  DXE62_RS00565 gpG 83444..83794 (+) 351 WP_000589165.1 phage tail assembly chaperone G -
  DXE62_RS00570 - 83836..83994 (+) 159 WP_000438833.1 hypothetical protein -
  DXE62_RS00575 - 84008..90208 (+) 6201 WP_114637614.1 phage tail tape measure protein -
  DXE62_RS00580 - 90208..91032 (+) 825 WP_031918864.1 phage tail family protein -
  DXE62_RS00585 - 91041..92624 (+) 1584 WP_000384474.1 prophage endopeptidase tail family protein -
  DXE62_RS00590 - 92624..92914 (+) 291 WP_000179860.1 hypothetical protein -
  DXE62_RS00595 - 92930..94840 (+) 1911 WP_000429551.1 minor structural protein -
  DXE62_RS00600 - 94840..96306 (+) 1467 WP_000067142.1 BppU family phage baseplate upper protein -
  DXE62_RS00605 - 96306..96695 (+) 390 WP_001166598.1 DUF2977 domain-containing protein -
  DXE62_RS00610 - 96688..96852 (+) 165 WP_000916021.1 XkdX family protein -
  DXE62_RS00615 - 96898..97197 (+) 300 WP_031861265.1 DUF2951 family protein -
  DXE62_RS00620 - 97333..97635 (+) 303 WP_000339141.1 phage holin -
  DXE62_RS00625 - 97647..99101 (+) 1455 WP_114637615.1 N-acetylmuramoyl-L-alanine amidase -
  DXE62_RS00635 - 99839..100348 (+) 510 Protein_124 Fic family protein -
  DXE62_RS00640 sel26 100763..101515 (+) 753 WP_001807829.1 staphylococcal enterotoxin type 26 -
  DXE62_RS00645 - 101718..101987 (-) 270 WP_000829750.1 hypothetical protein -
  DXE62_RS00650 mtnN 102301..102987 (+) 687 WP_000579272.1 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase -
  DXE62_RS00655 - 103007..103534 (+) 528 WP_000524902.1 YqeG family HAD IIIA-type phosphatase -
  DXE62_RS00660 yqeH 103535..104635 (+) 1101 WP_001280151.1 ribosome biogenesis GTPase YqeH -
  DXE62_RS00665 aroE 104649..105455 (+) 807 WP_000666746.1 shikimate dehydrogenase -
  DXE62_RS00670 yhbY 105459..105749 (+) 291 WP_000955234.1 ribosome assembly RNA-binding protein YhbY -
  DXE62_RS00675 nadD 105752..106321 (+) 570 WP_000725164.1 nicotinate (nicotinamide) nucleotide adenylyltransferase -
  DXE62_RS00680 yqeK 106311..106895 (+) 585 WP_001019324.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
  DXE62_RS00685 rsfS 106896..107249 (+) 354 WP_001088020.1 ribosome silencing factor -
  DXE62_RS00690 - 107252..107968 (+) 717 WP_000084838.1 class I SAM-dependent DNA methyltransferase -
  DXE62_RS00695 comEA 108008..108694 (+) 687 WP_001825349.1 ComEA family DNA-binding protein Machinery gene
  DXE62_RS00700 - 108786..109247 (+) 462 WP_000439690.1 ComE operon protein 2 -
  DXE62_RS00705 comEC 109252..111453 (+) 2202 WP_001807826.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene
  DXE62_RS00710 holA 111510..112484 (+) 975 WP_001282570.1 DNA polymerase III subunit delta -

Sequence


Protein


Download         Length: 228 a.a.        Molecular weight: 25783.41 Da        Isoelectric Point: 9.3305

>NTDB_id=1149580 DXE62_RS00695 WP_001825349.1 108008..108694(+) (comEA) [Staphylococcus aureus isolate 6_LA_232]
MVLLYQFLLRYKDFLTQWKLYIISAVVLIMVLIGFIFWRQDDYTSRDFENKDTALKQSTSENSSLSKLEDVQVKDGDDSK
NKGPVYVDIKGAVKHPNVYKMTSKDRVVDLLDKAQLLDDADVSQINLSEKLTDQKMIFIPHKGQKNVEPQFGANSVHVKN
GNTNNTKVNLNTASVSELMSVPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT

Nucleotide


Download         Length: 687 bp        

>NTDB_id=1149580 DXE62_RS00695 WP_001825349.1 108008..108694(+) (comEA) [Staphylococcus aureus isolate 6_LA_232]
GTGGTTTTATTGTATCAATTTTTATTACGCTATAAAGATTTTTTAACTCAATGGAAGTTATATATTATAAGTGCTGTTGT
TTTAATTATGGTATTAATTGGTTTTATATTCTGGAGACAAGATGATTATACTTCAAGAGATTTTGAAAATAAAGATACTG
CTCTGAAACAAAGCACTAGTGAAAATAGTAGTTTGTCCAAATTAGAAGATGTCCAGGTCAAAGATGGAGATGATTCCAAA
AATAAAGGTCCTGTATATGTCGATATAAAAGGTGCTGTTAAACATCCTAATGTTTATAAAATGACATCTAAGGATAGAGT
AGTTGATTTACTTGATAAAGCACAATTATTAGATGATGCAGATGTAAGTCAAATTAATTTGTCTGAAAAATTAACAGATC
AAAAAATGATTTTCATTCCTCATAAAGGACAAAAGAATGTTGAACCACAATTTGGAGCAAACAGTGTGCACGTAAAAAAT
GGGAACACAAATAATACTAAAGTAAATTTAAATACGGCATCTGTATCAGAATTGATGTCTGTTCCTGGAGTAGGGCAAGC
TAAAGCTAATGCAATTGTTGAATATCGCAACCAACAAGGTGCATTTCAAGAAATTGACGATTTGAAAAAAGTAAAAGGTT
TTGGAAGTAAAACTTTTGATAAACTGAAATCTTATTTCACGACATAA

Domains


Predicted by InterproScan.

(164-227)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Staphylococcus aureus MW2

96.476

99.561

0.961

  comEA Staphylococcus aureus N315

96.476

99.561

0.961


Multiple sequence alignment