Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DXE63_RS06490 | Genome accession | NZ_LT992458 |
| Coordinates | 1266504..1266899 (+) | Length | 131 a.a. |
| NCBI ID | WP_000932694.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate 7_4623 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1231326..1285874 | 1266504..1266899 | within | 0 |
Gene organization within MGE regions
Location: 1231326..1285874
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE63_RS06290 | - | 1231425..1231895 (-) | 471 | WP_000164421.1 | S-ribosylhomocysteine lyase | - |
| DXE63_RS06295 | - | 1232204..1233388 (+) | 1185 | WP_001291508.1 | M20 family metallopeptidase | - |
| DXE63_RS06300 | ldmS | 1233388..1234581 (+) | 1194 | WP_000183714.1 | L-aspartate--L-methionine ligase LdmS | - |
| DXE63_RS06305 | - | 1234980..1235651 (+) | 672 | WP_000120549.1 | DUF2750 domain-containing protein | - |
| DXE63_RS06310 | coaW | 1235781..1236584 (-) | 804 | WP_000862732.1 | type II pantothenate kinase | - |
| DXE63_RS06315 | - | 1237009..1237869 (+) | 861 | WP_001040736.1 | GNAT family N-acetyltransferase | - |
| DXE63_RS06320 | rpoE | 1237981..1238511 (+) | 531 | WP_000701483.1 | DNA-directed RNA polymerase subunit delta | - |
| DXE63_RS06325 | - | 1238847..1240457 (+) | 1611 | WP_000159960.1 | CTP synthase | - |
| DXE63_RS06330 | - | 1240566..1241087 (-) | 522 | WP_000036005.1 | DUF2529 domain-containing protein | - |
| DXE63_RS06335 | fdaB | 1241305..1242165 (+) | 861 | WP_001131841.1 | class IIb fructose-bisphosphate aldolase FdaB | - |
| DXE63_RS06340 | - | 1242631..1243890 (+) | 1260 | WP_000046613.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| DXE63_RS06345 | - | 1243979..1244314 (+) | 336 | WP_000451437.1 | winged helix-turn-helix transcriptional regulator | - |
| DXE63_RS06350 | - | 1244552..1245979 (+) | 1428 | WP_001206109.1 | aldehyde dehydrogenase family protein | - |
| DXE63_RS06355 | rho | 1246226..1247542 (+) | 1317 | WP_001115100.1 | transcription termination factor Rho | - |
| DXE63_RS06360 | - | 1247660..1247914 (+) | 255 | WP_000808968.1 | type B 50S ribosomal protein L31 | - |
| DXE63_RS06370 | - | 1248261..1248860 (+) | 600 | WP_000273356.1 | thymidine kinase | - |
| DXE63_RS06375 | prfA | 1248861..1249937 (+) | 1077 | WP_000467900.1 | peptide chain release factor 1 | - |
| DXE63_RS06380 | prmC | 1249924..1250760 (+) | 837 | WP_000248730.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| DXE63_RS06385 | - | 1250844..1251890 (+) | 1047 | WP_000379903.1 | L-threonylcarbamoyladenylate synthase | - |
| DXE63_RS06390 | - | 1251887..1252306 (+) | 420 | WP_000697332.1 | low molecular weight protein arginine phosphatase | - |
| DXE63_RS06395 | - | 1252413..1252937 (+) | 525 | WP_000654181.1 | TIGR01440 family protein | - |
| DXE63_RS06400 | glyA | 1252964..1254202 (+) | 1239 | WP_000120490.1 | serine hydroxymethyltransferase | - |
| DXE63_RS06405 | upp | 1254230..1254859 (+) | 630 | WP_000048712.1 | uracil phosphoribosyltransferase | - |
| DXE63_RS06410 | wecB | 1254883..1256010 (+) | 1128 | WP_000723408.1 | non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase | - |
| DXE63_RS06415 | - | 1256078..1256530 (+) | 453 | WP_001825751.1 | ATP synthase subunit I | - |
| DXE63_RS06420 | atpB | 1256551..1257279 (+) | 729 | WP_000349655.1 | F0F1 ATP synthase subunit A | - |
| DXE63_RS06425 | atpE | 1257322..1257534 (+) | 213 | WP_001048816.1 | F0F1 ATP synthase subunit C | - |
| DXE63_RS06430 | - | 1257732..1258253 (+) | 522 | WP_000140679.1 | F0F1 ATP synthase subunit B | - |
| DXE63_RS06435 | - | 1258253..1258792 (+) | 540 | WP_000241344.1 | F0F1 ATP synthase subunit delta | - |
| DXE63_RS06440 | atpA | 1258814..1260322 (+) | 1509 | WP_000974881.1 | F0F1 ATP synthase subunit alpha | - |
| DXE63_RS06445 | atpG | 1260353..1261219 (+) | 867 | WP_000157603.1 | ATP synthase F1 subunit gamma | - |
| DXE63_RS06450 | atpD | 1261241..1262653 (+) | 1413 | WP_000511139.1 | F0F1 ATP synthase subunit beta | - |
| DXE63_RS06455 | - | 1262673..1263077 (+) | 405 | WP_001094394.1 | F0F1 ATP synthase subunit epsilon | - |
| DXE63_RS06470 | - | 1263730..1263963 (+) | 234 | WP_000384523.1 | DUF1146 family protein | - |
| DXE63_RS06475 | murA | 1264074..1265339 (+) | 1266 | WP_000358009.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| DXE63_RS06480 | fabZ | 1265373..1265813 (+) | 441 | WP_000447678.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| DXE63_RS06485 | - | 1265870..1266310 (-) | 441 | WP_000846746.1 | YwpF-like family protein | - |
| DXE63_RS06490 | ssb | 1266504..1266899 (+) | 396 | WP_000932694.1 | single-stranded DNA-binding protein | Machinery gene |
| DXE63_RS06495 | sceD | 1267288..1267983 (+) | 696 | WP_000751995.1 | lytic transglycosylase SceD | - |
| DXE63_RS06500 | tenA | 1268370..1269059 (+) | 690 | WP_000396068.1 | thiaminase II | - |
| DXE63_RS06505 | - | 1269052..1269552 (+) | 501 | Protein_1225 | PfkB family carbohydrate kinase | - |
| DXE63_RS06510 | - | 1269773..1270309 (-) | 537 | WP_078367270.1 | IS30 family transposase | - |
| DXE63_RS06515 | - | 1270290..1270793 (-) | 504 | WP_000746373.1 | transposase | - |
| DXE63_RS06520 | - | 1270902..1271258 (-) | 357 | WP_001255379.1 | cystatin-like fold lipoprotein | - |
| DXE63_RS06525 | - | 1271314..1271904 (-) | 591 | WP_000810443.1 | hypothetical protein | - |
| DXE63_RS06530 | - | 1271911..1272957 (-) | 1047 | WP_114621336.1 | CHAP domain-containing protein | - |
| DXE63_RS06535 | - | 1272947..1274794 (-) | 1848 | WP_000681156.1 | CD3337/EF1877 family mobilome membrane protein | - |
| DXE63_RS06540 | - | 1274799..1276157 (-) | 1359 | WP_001251209.1 | FtsK/SpoIIIE domain-containing protein | - |
| DXE63_RS06545 | - | 1276211..1278706 (-) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| DXE63_RS06550 | - | 1278741..1279124 (-) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| DXE63_RS06555 | - | 1279136..1279396 (-) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| DXE63_RS06560 | - | 1279401..1280456 (-) | 1056 | WP_000692002.1 | conjugal transfer protein | - |
| DXE63_RS06565 | - | 1280517..1281608 (-) | 1092 | WP_000172943.1 | replication initiation factor domain-containing protein | - |
| DXE63_RS06570 | - | 1281783..1282085 (-) | 303 | WP_000386891.1 | hypothetical protein | - |
| DXE63_RS06575 | - | 1282099..1282419 (-) | 321 | WP_000805733.1 | DUF961 family protein | - |
| DXE63_RS06580 | - | 1282570..1282854 (-) | 285 | WP_114621337.1 | hypothetical protein | - |
| DXE63_RS06585 | - | 1282907..1283239 (+) | 333 | Protein_1241 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| DXE63_RS06590 | thiM | 1283223..1284014 (+) | 792 | WP_001108486.1 | hydroxyethylthiazole kinase | - |
| DXE63_RS06595 | thiE | 1284016..1284657 (+) | 642 | WP_000483161.1 | thiamine phosphate synthase | - |
| DXE63_RS06600 | yidC | 1284743..1285615 (+) | 873 | WP_000725800.1 | membrane protein insertase YidC | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 15042.09 Da Isoelectric Point: 5.6824
>NTDB_id=1149318 DXE63_RS06490 WP_000932694.1 1266504..1266899(+) (ssb) [Staphylococcus aureus isolate 7_4623]
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
Nucleotide
Download Length: 396 bp
>NTDB_id=1149318 DXE63_RS06490 WP_000932694.1 1266504..1266899(+) (ssb) [Staphylococcus aureus isolate 7_4623]
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATACACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATACACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Staphylococcus aureus N315 |
100 |
100 |
1 |
| ssb | Staphylococcus aureus MW2 |
99.237 |
100 |
0.992 |