Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V529_RS12495 Genome accession   NZ_CP006890
Coordinates   2659349..2659663 (-) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis SQR9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2654349..2664663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V529_RS12450 (V529_25670) sinI 2655030..2655203 (+) 174 WP_007612543.1 anti-repressor SinI family protein Regulator
  V529_RS12455 (V529_25680) sinR 2655237..2655572 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V529_RS12460 (V529_25690) - 2655620..2656405 (-) 786 WP_003153102.1 TasA family protein -
  V529_RS12465 (V529_25700) - 2656470..2657054 (-) 585 WP_012117977.1 signal peptidase I -
  V529_RS12470 (V529_25710) tapA 2657026..2657697 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  V529_RS12475 (V529_25720) - 2657956..2658285 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  V529_RS12480 (V529_25730) - 2658326..2658505 (-) 180 WP_022552966.1 YqzE family protein -
  V529_RS12485 (V529_25740) comGG 2658562..2658939 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  V529_RS12490 (V529_25750) comGF 2658940..2659440 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  V529_RS12495 (V529_25760) comGE 2659349..2659663 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  V529_RS12500 (V529_25770) comGD 2659647..2660084 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  V529_RS12505 (V529_25780) comGC 2660074..2660382 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V529_RS12510 (V529_25790) comGB 2660387..2661424 (-) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  V529_RS12515 (V529_25800) comGA 2661411..2662481 (-) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  V529_RS12520 (V529_25810) - 2662678..2663628 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=114845 V529_RS12495 WP_038459179.1 2659349..2659663(-) (comGE) [Bacillus velezensis SQR9]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=114845 V529_RS12495 WP_038459179.1 2659349..2659663(-) (comGE) [Bacillus velezensis SQR9]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment