Detailed information    

insolico Bioinformatically predicted

Overview


Name   comFC   Type   Machinery gene
Locus tag   MFPB19_RS02690 Genome accession   NZ_LT960784
Coordinates   543284..543979 (+) Length   231 a.a.
NCBI ID   WP_147658291.1    Uniprot ID   -
Organism   Latilactobacillus sakei isolate MFPB19     
Function   ssDNA transport into the cell (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 522865..563767 543284..543979 within 0


Gene organization within MGE regions


Location: 522865..563767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MFPB19_RS02605 (MFPB19_0542) - 524373..524810 (-) 438 WP_099713118.1 GNAT family N-acetyltransferase -
  MFPB19_RS02610 (MFPB19_0543) - 524974..525951 (-) 978 WP_011374185.1 GMP reductase -
  MFPB19_RS02615 (MFPB19_0544) - 526098..527051 (-) 954 WP_011374186.1 magnesium transporter CorA family protein -
  MFPB19_RS02620 (MFPB19_0545) - 527140..527976 (+) 837 WP_016264719.1 methyltransferase domain-containing protein -
  MFPB19_RS02625 (MFPB19_0546) trmL 528229..528738 (+) 510 WP_011374188.1 tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL -
  MFPB19_RS02630 (MFPB19_0547) - 528750..529157 (+) 408 WP_011374189.1 DUF1149 family protein -
  MFPB19_RS02635 (MFPB19_0548) - 529297..531666 (+) 2370 WP_011374190.1 FtsK/SpoIIIE family DNA translocase -
  MFPB19_RS02640 (MFPB19_0549) yfmF 531864..533135 (+) 1272 WP_011374191.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  MFPB19_RS02645 (MFPB19_0550) yfmH 533125..534429 (+) 1305 WP_025016333.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  MFPB19_RS02650 (MFPB19_0551) ymfI 534429..535160 (+) 732 WP_099713117.1 elongation factor P 5-aminopentanone reductase -
  MFPB19_RS02655 (MFPB19_0552) - 535242..536165 (+) 924 WP_011374194.1 helix-turn-helix domain-containing protein -
  MFPB19_RS02660 (MFPB19_0553) pgsA 536191..536775 (+) 585 WP_011374195.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  MFPB19_RS02665 (MFPB19_0554) recA 536958..538025 (+) 1068 WP_011374196.1 recombinase RecA Machinery gene
  MFPB19_RS02670 (MFPB19_0555) rny 538412..539977 (+) 1566 WP_076632200.1 ribonuclease Y -
  MFPB19_RS02675 (MFPB19_0556) - 540130..541218 (+) 1089 WP_056948881.1 glycosyltransferase family 4 protein -
  MFPB19_RS02680 (MFPB19_0557) - 541244..541909 (-) 666 WP_056948841.1 YigZ family protein -
  MFPB19_RS02685 (MFPB19_0558) comFA 541971..543308 (+) 1338 WP_056948838.1 DEAD/DEAH box helicase Machinery gene
  MFPB19_RS02690 (MFPB19_0559) comFC 543284..543979 (+) 696 WP_147658291.1 ComF family protein Machinery gene
  MFPB19_RS02695 (MFPB19_0560) hpf 544106..544651 (+) 546 WP_056948836.1 ribosome hibernation-promoting factor, HPF/YfiA family -
  MFPB19_RS02700 (MFPB19_0561) secA 544900..547263 (+) 2364 WP_011374203.1 preprotein translocase subunit SecA -
  MFPB19_RS02705 (MFPB19_0562) prfB 547333..548449 (+) 1117 WP_099049013.1 peptide chain release factor 2 -
  MFPB19_RS02710 (MFPB19_0563) ftsE 548580..549266 (+) 687 WP_011374205.1 cell division ATP-binding protein FtsE -
  MFPB19_RS02715 (MFPB19_0564) ftsX 549256..550143 (+) 888 WP_016264727.1 permease-like cell division protein FtsX -
  MFPB19_RS02720 (MFPB19_0565) - 550337..551470 (+) 1134 WP_016264728.1 PDZ domain-containing protein -
  MFPB19_RS02725 (MFPB19_0566) - 551490..552203 (+) 714 WP_099713116.1 response regulator transcription factor -
  MFPB19_RS02730 (MFPB19_0567) pnpS 552190..553851 (+) 1662 WP_099713115.1 two-component system histidine kinase PnpS -
  MFPB19_RS02735 (MFPB19_0568) - 553944..554804 (+) 861 WP_076632197.1 phosphate ABC transporter substrate-binding protein PstS family protein -
  MFPB19_RS02740 (MFPB19_0569) pstC 554814..555737 (+) 924 WP_011374211.1 phosphate ABC transporter permease subunit PstC -
  MFPB19_RS02745 (MFPB19_0570) pstA 555737..556621 (+) 885 WP_016264731.1 phosphate ABC transporter permease PstA -
  MFPB19_RS02750 (MFPB19_0571) pstB 556631..557440 (+) 810 WP_011374213.1 phosphate ABC transporter ATP-binding protein PstB -
  MFPB19_RS02755 (MFPB19_0572) pstB 557461..558219 (+) 759 WP_011374214.1 phosphate ABC transporter ATP-binding protein PstB -
  MFPB19_RS02760 (MFPB19_0573) phoU 558236..558913 (+) 678 WP_011374215.1 phosphate signaling complex protein PhoU -
  MFPB19_RS02765 (MFPB19_0574) - 559143..559613 (+) 471 WP_056948830.1 nucleoside 2-deoxyribosyltransferase -
  MFPB19_RS02770 (MFPB19_0575) - 559733..560599 (+) 867 Protein_524 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  MFPB19_RS02775 (MFPB19_0576) - 560619..561566 (+) 948 WP_099713114.1 L-threonine 3-dehydrogenase -
  MFPB19_RS02780 (MFPB19_0577) liaX 561753..563228 (+) 1476 WP_099712930.1 daptomycin-sensing surface protein LiaX -
  MFPB19_RS02785 (MFPB19_0578) - 563256..563492 (+) 237 WP_099712931.1 PspC domain-containing protein -
  MFPB19_RS02790 (MFPB19_0579) - 563492..563767 (+) 276 WP_099712932.1 hypothetical protein -

Sequence


Protein


Download         Length: 231 a.a.        Molecular weight: 26933.39 Da        Isoelectric Point: 9.4488

>NTDB_id=1148423 MFPB19_RS02690 WP_147658291.1 543284..543979(+) (comFC) [Latilactobacillus sakei isolate MFPB19]
MAITINCLMCQNVIIEKPSIKQLLQLKPLLKPHICQICLQQFEPISGNQCSDCSRPLLTGILCSDCQHWRQLYPQQHFKN
QALFTYNRAMQLYFQRYKGQGDYQLRLLFERDIQTRFPVKPNVAYVPIPSDEQHQQARGFNPVQGLFENCFPLMSLLKKR
PTEKGQAQKNRAERLASPQFFELIPQKLPDKLQSITILDDIYTTGRTLWHAQQCLRARYPQITINAITLAR

Nucleotide


Download         Length: 696 bp        

>NTDB_id=1148423 MFPB19_RS02690 WP_147658291.1 543284..543979(+) (comFC) [Latilactobacillus sakei isolate MFPB19]
ATGGCGATTACAATCAACTGTTTAATGTGTCAAAATGTCATTATTGAAAAGCCAAGTATTAAACAACTGCTACAACTAAA
ACCACTACTTAAACCGCATATCTGTCAAATTTGTTTACAGCAGTTTGAACCTATCAGTGGCAACCAGTGTTCGGATTGTA
GTCGGCCACTATTGACGGGCATTTTATGTTCTGATTGTCAGCATTGGCGACAACTTTACCCCCAACAGCATTTTAAAAAT
CAAGCATTGTTTACTTATAATCGGGCGATGCAGTTATATTTTCAACGTTATAAGGGCCAAGGAGATTATCAATTACGGTT
ACTATTTGAACGGGACATTCAAACGCGGTTTCCAGTAAAGCCCAATGTAGCTTACGTGCCGATCCCATCCGATGAGCAAC
ATCAACAAGCACGCGGTTTTAATCCAGTCCAAGGCTTATTCGAAAATTGTTTTCCGCTAATGTCACTCTTGAAAAAGCGA
CCAACGGAAAAGGGGCAAGCGCAAAAAAATCGTGCAGAACGACTCGCAAGTCCGCAATTTTTTGAATTAATACCACAAAA
GTTACCTGATAAGCTACAGTCGATAACGATTCTAGATGATATTTACACGACCGGTCGAACGTTGTGGCATGCTCAGCAAT
GTCTGCGTGCTCGTTATCCGCAAATTACAATTAATGCAATTACTTTGGCCAGATAG

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comFC Latilactobacillus sakei subsp. sakei 23K

91.549

61.472

0.563


Multiple sequence alignment