Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CS888_RS00220 Genome accession   NZ_LT635473
Coordinates   40241..40354 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori isolate HE136/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 35241..45354
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS888_RS00195 - 35282..37510 (+) 2229 WP_089086473.1 AAA family ATPase -
  CS888_RS00200 panD 37500..37853 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  CS888_RS00205 - 37856..38158 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CS888_RS00210 - 38158..39162 (+) 1005 WP_089086474.1 PDZ domain-containing protein -
  CS888_RS00215 comB6 39170..40225 (+) 1056 WP_089086475.1 P-type conjugative transfer protein TrbL Machinery gene
  CS888_RS00220 comB7 40241..40354 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  CS888_RS00225 comB8 40351..41094 (+) 744 WP_000660557.1 type IV secretion system protein Machinery gene
  CS888_RS00230 comB9 41094..42080 (+) 987 WP_089086476.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CS888_RS00235 comB10 42073..43209 (+) 1137 WP_089086477.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS888_RS00240 - 43279..44691 (+) 1413 WP_089086478.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=1145783 CS888_RS00220 WP_001217877.1 40241..40354(+) (comB7) [Helicobacter pylori isolate HE136/09]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1145783 CS888_RS00220 WP_001217877.1 40241..40354(+) (comB7) [Helicobacter pylori isolate HE136/09]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment