Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB10   Type   Machinery gene
Locus tag   CS893_RS02490 Genome accession   NZ_LT635460
Coordinates   498165..499370 (-) Length   401 a.a.
NCBI ID   WP_089086745.1    Uniprot ID   A0A238GUL3
Organism   Helicobacter pylori isolate HE178/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 446989..528534 498165..499370 within 0


Gene organization within MGE regions


Location: 446989..528534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS893_RS02270 - 447845..450124 (-) 2280 WP_231899392.1 DEAD/DEAH box helicase family protein -
  CS893_RS08395 - 450298..450989 (-) 692 Protein_433 type I restriction endonuclease -
  CS893_RS02275 - 451037..452932 (-) 1896 WP_089086720.1 motility associated factor glycosyltransferase family protein -
  CS893_RS02280 - 452957..453724 (-) 768 WP_089086721.1 TerB family tellurite resistance protein -
  CS893_RS02285 - 453734..454048 (-) 315 WP_001878784.1 hypothetical protein -
  CS893_RS02290 - 454050..455537 (-) 1488 WP_089086722.1 DUF5644 domain-containing protein -
  CS893_RS02295 - 455549..456037 (-) 489 WP_089086723.1 hypothetical protein -
  CS893_RS02300 - 456022..457758 (-) 1737 WP_089086724.1 M3 family oligoendopeptidase -
  CS893_RS02305 - 457855..459105 (-) 1251 WP_000431942.1 cation:proton antiporter -
  CS893_RS08400 - 459259..459441 (-) 183 Protein_441 hypothetical protein -
  CS893_RS02315 - 459425..459985 (-) 561 WP_000595776.1 outer membrane beta-barrel protein -
  CS893_RS02320 modA 460211..460951 (+) 741 WP_089086725.1 molybdate ABC transporter substrate-binding protein -
  CS893_RS02325 modB 460974..461648 (+) 675 WP_000349430.1 molybdate ABC transporter permease subunit -
  CS893_RS02330 - 461645..462442 (+) 798 WP_089086726.1 ATP-binding cassette domain-containing protein -
  CS893_RS02335 gltX 462560..463951 (-) 1392 WP_089086727.1 glutamate--tRNA ligase -
  CS893_RS02340 hopJ 464069..465181 (+) 1113 WP_089086728.1 Hop family outer membrane protein HopJ/HopK -
  CS893_RS02345 - 465190..466827 (+) 1638 Protein_448 TaqI-like C-terminal specificity domain-containing protein -
  CS893_RS02350 - 466793..467641 (+) 849 WP_089086729.1 glycosyltransferase family 9 protein -
  CS893_RS02355 typA 467687..469486 (+) 1800 WP_000790195.1 translational GTPase TypA -
  CS893_RS02360 - 469502..469899 (+) 398 Protein_451 DNA adenine methylase -
  CS893_RS02365 - 470657..472690 (+) 2034 WP_089086730.1 relaxase/mobilization nuclease domain-containing protein -
  CS893_RS02370 - 473843..474910 (+) 1068 Protein_453 tyrosine-type recombinase/integrase -
  CS893_RS02375 - 475227..476030 (-) 804 WP_089086732.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS893_RS02380 - 476002..476253 (-) 252 WP_000006537.1 hypothetical protein -
  CS893_RS02385 - 476385..477065 (-) 681 WP_001153463.1 hypothetical protein -
  CS893_RS02390 - 477286..478299 (+) 1014 WP_089086733.1 hypothetical protein -
  CS893_RS08285 - 478304..479579 (-) 1276 Protein_458 hypothetical protein -
  CS893_RS02400 - 479576..480838 (-) 1263 WP_089086734.1 type IV secretion system protein -
  CS893_RS02405 - 480835..482268 (-) 1434 WP_089086735.1 hypothetical protein -
  CS893_RS02410 - 482278..484323 (-) 2046 Protein_461 hypothetical protein -
  CS893_RS02415 - 484323..485375 (-) 1053 WP_089086736.1 ArdC family protein -
  CS893_RS08290 - 485376..485540 (-) 165 WP_000189763.1 hypothetical protein -
  CS893_RS02425 - 486178..486846 (+) 669 WP_089086737.1 ParA family protein -
  CS893_RS02430 - 486893..487270 (+) 378 WP_000365707.1 hypothetical protein -
  CS893_RS02435 - 487248..487913 (+) 666 WP_089086738.1 hypothetical protein -
  CS893_RS02440 - 487987..488790 (-) 804 WP_089086739.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS893_RS02445 - 488760..489230 (-) 471 WP_000965788.1 hypothetical protein -
  CS893_RS02450 - 489285..491345 (-) 2061 WP_001942503.1 type IA DNA topoisomerase -
  CS893_RS02460 - 491366..493609 (-) 2244 Protein_470 type IV secretory system conjugative DNA transfer family protein -
  CS893_RS02465 - 493606..493833 (-) 228 Protein_471 replication regulatory RepB family protein -
  CS893_RS02470 - 493803..494687 (-) 885 WP_089086741.1 ATPase, T2SS/T4P/T4SS family -
  CS893_RS02475 - 494692..494967 (-) 276 WP_089086742.1 hypothetical protein -
  CS893_RS02480 - 494984..495946 (-) 963 WP_089086743.1 hypothetical protein -
  CS893_RS02485 - 495959..498181 (-) 2223 WP_089086744.1 RGS domain-containing GTPase-activating protein -
  CS893_RS02490 comB10 498165..499370 (-) 1206 WP_089086745.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS893_RS02495 - 499367..501022 (-) 1656 WP_000617227.1 TrbG/VirB9 family P-type conjugative transfer protein -
  CS893_RS02500 - 501019..502155 (-) 1137 WP_089086746.1 VirB8/TrbF family protein -
  CS893_RS08405 - 502148..502288 (-) 141 WP_000789928.1 hypothetical protein -
  CS893_RS02510 - 502285..504835 (-) 2551 Protein_480 VirB4 family type IV secretion/conjugal transfer ATPase -
  CS893_RS02515 - 504835..505071 (-) 237 WP_001168537.1 hypothetical protein -
  CS893_RS02520 comB3 505083..505346 (-) 264 WP_001177718.1 hypothetical protein Machinery gene
  CS893_RS02525 comB2 505358..505642 (-) 285 WP_000413637.1 TrbC/VirB2 family protein Machinery gene
  CS893_RS02530 - 505630..506118 (-) 489 WP_089086747.1 hypothetical protein -
  CS893_RS02535 - 506182..506340 (-) 159 WP_231899360.1 hypothetical protein -
  CS893_RS02540 - 506343..507143 (-) 801 WP_089086748.1 integrase -
  CS893_RS02545 - 507198..507734 (+) 537 Protein_487 DNA adenine methylase -
  CS893_RS02550 - 507737..508360 (+) 624 WP_089086749.1 GIY-YIG nuclease family protein -
  CS893_RS02555 - 508508..508870 (+) 363 Protein_489 DNA cytosine methyltransferase -
  CS893_RS02560 - 509030..509974 (-) 945 WP_089086751.1 catalase family peroxidase -
  CS893_RS02565 hofC 510261..511847 (+) 1587 WP_089086752.1 outer membrane beta-barrel protein HofC -
  CS893_RS02570 hofD 511919..513316 (+) 1398 WP_089086753.1 outer membrane beta-barrel protein HofD -
  CS893_RS08295 - 513546..513746 (-) 201 WP_089086754.1 hypothetical protein -
  CS893_RS02585 - 513715..516093 (+) 2379 WP_231899382.1 DUF3519 domain-containing protein -
  CS893_RS02590 - 516103..516524 (+) 422 Protein_495 hypothetical protein -
  CS893_RS02595 - 516521..517068 (+) 548 Protein_496 hypothetical protein -
  CS893_RS02600 - 517308..518444 (-) 1137 WP_000461999.1 potassium channel family protein -
  CS893_RS02610 rpmB 518631..518819 (-) 189 WP_001118998.1 50S ribosomal protein L28 -
  CS893_RS02615 - 518912..519751 (-) 840 WP_089086759.1 HpaA family protein -
  CS893_RS02620 mraY 519882..520943 (+) 1062 WP_089087378.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  CS893_RS02625 murD 520945..522213 (+) 1269 WP_089086760.1 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase -
  CS893_RS02630 - 522210..522470 (-) 261 WP_089086761.1 DUF493 family protein -
  CS893_RS02635 - 522460..522768 (-) 309 WP_089086762.1 hotdog domain-containing protein -
  CS893_RS02640 - 523001..524329 (+) 1329 WP_000526620.1 sodium-dependent transporter -
  CS893_RS02645 - 524340..525668 (+) 1329 WP_089086763.1 sodium-dependent transporter -
  CS893_RS02650 - 525683..526749 (+) 1067 Protein_506 phospholipase A -
  CS893_RS02655 dnaN 526805..527929 (+) 1125 WP_089086764.1 DNA polymerase III subunit beta -

Sequence

Protein


Download         Length: 401 a.a.        Molecular weight: 44905.59 Da        Isoelectric Point: 10.1066

>NTDB_id=1145722 CS893_RS02490 WP_089086745.1 498165..499370(-) (comB10) [Helicobacter pylori isolate HE178/09]
MKQSLLKKIGLGVGGFVVLMALGLLANKGSNNNNKEEIFQVSESKFPLSDYFFEEVKEEPKKAKETPEVTTQEPTTQTSP
NPSVSANPNIKDYSHLNNNLNQQNNTITHLQQVLQSPSKIKPKPKHTKEQLEFLNTRLKPLEPTKPATKPEMEYGVDSFT
NLKYKDIGTNEHKLLRTITADRMIPAFLITPISSQIAGKVTAQVESDIFASMGRAVLIPKGSKVIGYYNNNNQIGQYRLN
IAWTRIITPQGINIMLTNARGADVKGYNGLVGKYISRNFQRYGIPLLTNTLSNGLLIGITSALANRQNRKGDGNPFFGDY
LLMQLTRNTGMGINQVINQMLRQYGAQNPIIIIREGSRVFISPNLDIFIPKPKDGEVLAEFFKEKKPLIKTKEEINNEEE
I

Nucleotide


Download         Length: 1206 bp        

>NTDB_id=1145722 CS893_RS02490 WP_089086745.1 498165..499370(-) (comB10) [Helicobacter pylori isolate HE178/09]
ATGAAACAATCCTTGCTTAAAAAGATAGGCTTAGGTGTTGGGGGCTTTGTTGTTTTAATGGCATTAGGATTGCTTGCTAA
TAAAGGCTCAAACAATAACAATAAAGAAGAAATCTTTCAAGTAAGTGAGAGTAAATTCCCTTTAAGTGATTATTTCTTTG
AAGAAGTCAAAGAAGAGCCAAAAAAAGCCAAAGAAACACCAGAAGTAACTACCCAAGAGCCTACAACACAAACTAGCCCC
AATCCTAGTGTTTCAGCTAATCCTAACATTAAAGATTATAGTCATCTTAACAACAATCTTAATCAGCAAAATAATACTAT
CACGCATTTACAACAAGTTTTACAAAGCCCCTCTAAAATAAAGCCTAAACCAAAGCATACTAAAGAGCAATTAGAATTTT
TAAACACACGCCTTAAACCTTTAGAACCAACTAAACCAGCCACTAAGCCTGAGATGGAATACGGCGTGGATAGTTTTACT
AATTTAAAATATAAAGACATCGGCACTAATGAGCATAAGCTTTTAAGAACCATAACCGCTGATAGAATGATACCAGCCTT
TTTAATCACGCCTATTAGCTCTCAAATTGCTGGAAAAGTAACCGCCCAAGTAGAGAGCGATATATTTGCTTCTATGGGTA
GAGCGGTGCTAATCCCTAAAGGCTCTAAAGTTATAGGCTATTACAATAATAACAATCAAATTGGACAATACCGCCTTAAC
ATTGCTTGGACTAGAATTATCACGCCTCAAGGCATAAACATCATGCTCACTAACGCAAGGGGGGCTGATGTGAAGGGTTA
TAATGGCTTAGTAGGCAAATACATTAGCCGAAACTTTCAACGCTATGGTATCCCCTTACTCACTAACACGCTCTCTAATG
GTCTTTTAATAGGAATTACTTCAGCCTTAGCTAATAGGCAAAATAGAAAGGGTGATGGCAACCCTTTTTTTGGGGATTAC
TTGCTTATGCAACTCACTAGAAATACAGGCATGGGCATCAATCAAGTTATCAATCAAATGCTAAGGCAATATGGAGCGCA
AAACCCCATTATCATCATTAGAGAGGGGAGCAGAGTGTTTATTAGCCCTAATTTAGACATCTTTATCCCTAAACCAAAAG
ATGGGGAGGTTTTAGCGGAGTTCTTTAAAGAGAAAAAACCCCTAATCAAAACAAAAGAGGAAATTAACAATGAAGAAGAA
ATCTAA

Domains

Predicted by InterproScan.

Bacterial conjugation TrbI-like protein (TrbI)

(177-367)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A238GUL3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB10 Helicobacter pylori P1

52.821

97.257

0.514

Multiple sequence alignment