Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | C7R97_RS03280 | Genome accession | NZ_LT592161 |
| Coordinates | 565395..565868 (+) | Length | 157 a.a. |
| NCBI ID | WP_012503482.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain WHO_Y | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 565938..604204 | 565395..565868 | flank | 70 |
Gene organization within MGE regions
Location: 565395..604204
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7R97_RS03280 (WHOY_00594) | pilL | 565395..565868 (+) | 474 | WP_012503482.1 | PilX family type IV pilin | Machinery gene |
| C7R97_RS03285 (WHOY_00595C) | - | 565938..566246 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| C7R97_RS03290 | - | 566243..566954 (-) | 712 | Protein_566 | AzlC family ABC transporter permease | - |
| C7R97_RS03295 (WHOY_00598) | dut | 567120..567572 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| C7R97_RS03300 (WHOY_00599) | dapC | 567644..568831 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| C7R97_RS03305 (WHOY_00600) | yaaA | 568987..569766 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| C7R97_RS03320 | - | 570296..571496 (+) | 1201 | Protein_570 | tyrosine-type recombinase/integrase | - |
| C7R97_RS03335 (WHOY_00604C) | - | 571852..572121 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| C7R97_RS03340 (WHOY_00605C) | - | 572316..572999 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| C7R97_RS14190 | - | 573280..573546 (-) | 267 | Protein_573 | hypothetical protein | - |
| C7R97_RS03350 (WHOY_00607C) | - | 573657..573872 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| C7R97_RS03355 (WHOY_00608C) | - | 573924..574415 (-) | 492 | WP_047916888.1 | siphovirus Gp157 family protein | - |
| C7R97_RS03360 (WHOY_00609C) | - | 574412..574594 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| C7R97_RS03365 (WHOY_00610C) | - | 574734..575420 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| C7R97_RS03370 (WHOY_00611C) | - | 575489..575650 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| C7R97_RS03375 (WHOY_00612C) | - | 575647..575925 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| C7R97_RS03380 (WHOY_00613C) | - | 576078..576410 (-) | 333 | WP_003705604.1 | hypothetical protein | - |
| C7R97_RS03385 (WHOY_00614C) | - | 576551..576838 (-) | 288 | WP_115154430.1 | hypothetical protein | - |
| C7R97_RS03390 (WHOY_00615C) | - | 576835..577311 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| C7R97_RS03395 (WHOY_00616C) | - | 577344..577544 (-) | 201 | WP_047920246.1 | hypothetical protein | - |
| C7R97_RS03400 (WHOY_00617) | - | 578028..578246 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| C7R97_RS03405 (WHOY_00618C) | - | 578263..578622 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| C7R97_RS03410 (WHOY_00619C) | - | 578623..579162 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| C7R97_RS03415 (WHOY_00620C) | - | 579322..580038 (-) | 717 | WP_003695999.1 | XRE family transcriptional regulator | - |
| C7R97_RS03425 (WHOY_00621) | - | 580419..580646 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| C7R97_RS03430 (WHOY_00623) | - | 580764..581828 (+) | 1065 | WP_050154181.1 | hypothetical protein | - |
| C7R97_RS03435 (WHOY_00624) | - | 581825..583186 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| C7R97_RS03440 (WHOY_00625) | - | 583203..583433 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| C7R97_RS03445 (WHOY_00626) | - | 583525..584019 (+) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| C7R97_RS03450 (WHOY_00627) | - | 584196..584345 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| C7R97_RS13665 (WHOY_00628) | - | 584374..584655 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| C7R97_RS03455 (WHOY_00629) | - | 584646..585083 (+) | 438 | WP_047918627.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C7R97_RS03460 (WHOY_00630) | - | 585076..585381 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| C7R97_RS03465 (WHOY_00631) | - | 585378..585761 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| C7R97_RS03470 (WHOY_00632) | - | 585752..586270 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| C7R97_RS03475 (WHOY_00633) | - | 586335..586757 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| C7R97_RS13670 (WHOY_00634) | - | 586757..587296 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| C7R97_RS03490 (WHOY_00635) | - | 587277..588551 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| C7R97_RS03495 (WHOY_00636) | - | 588536..590803 (+) | 2268 | WP_229689248.1 | hypothetical protein | - |
| C7R97_RS03500 (WHOY_00637) | - | 591040..592236 (+) | 1197 | WP_003687992.1 | hypothetical protein | - |
| C7R97_RS03505 (WHOY_00638) | - | 592233..593447 (+) | 1215 | WP_044270986.1 | hypothetical protein | - |
| C7R97_RS14370 (WHOY_00639) | - | 593650..599559 (+) | 5910 | WP_033909227.1 | PLxRFG domain-containing protein | - |
| C7R97_RS03520 (WHOY_00641) | - | 600185..601480 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| C7R97_RS03525 (WHOY_00642) | - | 601535..602008 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| C7R97_RS03530 (WHOY_00643) | - | 602014..602499 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| C7R97_RS03535 (WHOY_00644) | - | 602496..603170 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| C7R97_RS03540 (WHOY_00645) | - | 603173..603322 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| C7R97_RS03545 (WHOY_00646C) | - | 603359..604204 (-) | 846 | WP_047921371.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17486.30 Da Isoelectric Point: 9.9561
>NTDB_id=1144538 C7R97_RS03280 WP_012503482.1 565395..565868(+) (pilL) [Neisseria gonorrhoeae strain WHO_Y]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=1144538 C7R97_RS03280 WP_012503482.1 565395..565868(+) (pilL) [Neisseria gonorrhoeae strain WHO_Y]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.72 |
100 |
0.917 |
| pilX | Neisseria meningitidis 8013 |
85.35 |
100 |
0.854 |