Detailed information
Bioinformatically predicted
Overview
| Name | pilI | Type | Machinery gene |
| Locus tag | C7R99_RS03040 | Genome accession | NZ_LT592153 |
| Coordinates | 517978..518586 (+) | Length | 202 a.a. |
| NCBI ID | WP_106178882.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain WHO_Z | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 515567..558694 | 517978..518586 | within | 0 |
Gene organization within MGE regions
Location: 515567..558694
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7R99_RS03030 (WHOZ_00550) | dnaB | 515567..516973 (+) | 1407 | WP_003690896.1 | replicative DNA helicase | - |
| C7R99_RS03035 (WHOZ_00551) | pilH | 517281..517946 (+) | 666 | WP_003690897.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| C7R99_RS03040 (WHOZ_00552) | pilI | 517978..518586 (+) | 609 | WP_106178882.1 | type IV pilus modification protein PilV | Machinery gene |
| C7R99_RS03045 (WHOZ_00553) | pilJ | 518583..519524 (+) | 942 | WP_003690899.1 | PilW family protein | Machinery gene |
| C7R99_RS03050 (WHOZ_00554) | pilK | 519503..520111 (+) | 609 | WP_003690900.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| C7R99_RS03055 (WHOZ_00555) | pilL | 520113..520586 (+) | 474 | WP_025455782.1 | PilX family type IV pilin | Machinery gene |
| C7R99_RS03065 (WHOZ_00556C) | - | 521198..521643 (-) | 446 | Protein_524 | AzlC family ABC transporter permease | - |
| C7R99_RS03070 (WHOZ_00557) | dut | 521809..522261 (+) | 453 | WP_003690909.1 | dUTP diphosphatase | - |
| C7R99_RS03075 (WHOZ_00558) | dapC | 522339..523526 (+) | 1188 | WP_003690911.1 | succinyldiaminopimelate transaminase | - |
| C7R99_RS03080 (WHOZ_00559) | yaaA | 523682..524461 (+) | 780 | WP_003690913.1 | peroxide stress protein YaaA | - |
| C7R99_RS03095 (WHOZ_00562) | - | 524992..526188 (+) | 1197 | WP_003704323.1 | tyrosine-type recombinase/integrase | - |
| C7R99_RS03105 (WHOZ_00563C) | - | 526544..526813 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| C7R99_RS03110 (WHOZ_00564C) | - | 527008..527691 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| C7R99_RS14215 | - | 527972..528238 (-) | 267 | Protein_531 | hypothetical protein | - |
| C7R99_RS03120 (WHOZ_00566C) | - | 528349..528564 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| C7R99_RS03125 (WHOZ_00567C) | - | 528616..529107 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| C7R99_RS03130 (WHOZ_00568C) | - | 529104..529286 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| C7R99_RS03135 (WHOZ_00569C) | - | 529426..530112 (-) | 687 | WP_003691532.1 | phage replication initiation protein, NGO0469 family | - |
| C7R99_RS03140 (WHOZ_00570C) | - | 530181..530342 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| C7R99_RS03145 (WHOZ_00571C) | - | 530339..530617 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| C7R99_RS03150 (WHOZ_00572C) | - | 530770..531102 (-) | 333 | WP_003691528.1 | hypothetical protein | - |
| C7R99_RS03155 (WHOZ_00573C) | - | 531243..531530 (-) | 288 | WP_144858271.1 | hypothetical protein | - |
| C7R99_RS03160 (WHOZ_00574C) | - | 531527..532003 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| C7R99_RS03165 (WHOZ_00575C) | - | 532036..532236 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| C7R99_RS03170 (WHOZ_00576C) | - | 532434..532847 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| C7R99_RS03175 (WHOZ_00577C) | - | 532844..533305 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| C7R99_RS03180 (WHOZ_00578C) | - | 533322..533759 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| C7R99_RS03185 (WHOZ_00579C) | - | 533874..534590 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| C7R99_RS03190 (WHOZ_00580) | - | 534665..534895 (+) | 231 | WP_020997318.1 | transcriptional regulator | - |
| C7R99_RS03195 (WHOZ_00581) | - | 534975..535130 (+) | 156 | WP_047923772.1 | hypothetical protein | - |
| C7R99_RS03200 (WHOZ_00582C) | - | 535107..535295 (-) | 189 | WP_047926457.1 | hypothetical protein | - |
| C7R99_RS03205 (WHOZ_00583) | - | 535469..535696 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| C7R99_RS03210 (WHOZ_00584) | - | 535693..536703 (+) | 1011 | WP_014580341.1 | helix-turn-helix domain-containing protein | - |
| C7R99_RS03215 (WHOZ_00585) | - | 536715..537494 (+) | 780 | WP_025455804.1 | ATP-binding protein | - |
| C7R99_RS03220 | - | 537507..537770 (+) | 264 | WP_172616934.1 | hypothetical protein | - |
| C7R99_RS03225 (WHOZ_00586) | - | 537809..538303 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| C7R99_RS03235 (WHOZ_00587) | - | 538686..538835 (+) | 150 | WP_106178740.1 | hypothetical protein | - |
| C7R99_RS13690 (WHOZ_00588) | - | 538864..539145 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| C7R99_RS03240 (WHOZ_00589) | - | 539136..539573 (+) | 438 | WP_017147288.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C7R99_RS03245 (WHOZ_00590) | - | 539566..539871 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| C7R99_RS03250 (WHOZ_00591) | - | 539868..540251 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| C7R99_RS03255 (WHOZ_00592) | - | 540242..540760 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| C7R99_RS03260 (WHOZ_00593) | - | 540825..541247 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| C7R99_RS13695 (WHOZ_00594) | - | 541247..541786 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| C7R99_RS03275 (WHOZ_00595) | - | 541767..543041 (+) | 1275 | WP_014580143.1 | PBSX family phage terminase large subunit | - |
| C7R99_RS03280 (WHOZ_00596) | - | 543026..545293 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| C7R99_RS03285 (WHOZ_00597) | - | 545530..546726 (+) | 1197 | WP_003690925.1 | hypothetical protein | - |
| C7R99_RS03290 (WHOZ_00598) | - | 546723..547937 (+) | 1215 | WP_047954539.1 | hypothetical protein | - |
| C7R99_RS14345 (WHOZ_00599) | - | 548140..554049 (+) | 5910 | WP_033909227.1 | PLxRFG domain-containing protein | - |
| C7R99_RS03305 (WHOZ_00601) | - | 554675..555970 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| C7R99_RS03310 (WHOZ_00602) | - | 556025..556498 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| C7R99_RS03315 (WHOZ_00603) | - | 556504..556989 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| C7R99_RS03320 (WHOZ_00604) | - | 556986..557660 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| C7R99_RS03325 (WHOZ_00605) | - | 557663..557812 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| C7R99_RS03330 (WHOZ_00606C) | - | 557849..558694 (-) | 846 | WP_003690940.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 202 a.a. Molecular weight: 22060.06 Da Isoelectric Point: 4.9985
>NTDB_id=1144348 C7R99_RS03040 WP_106178882.1 517978..518586(+) (pilI) [Neisseria gonorrhoeae strain WHO_Z]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYMGSYTPTYSGGDFKLNNLISKKDLAKTQLDRFGYELKQALPDAVDIRYAVCKDSSGKAPTLSGGTFSSNCDDKANG
DTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYMGSYTPTYSGGDFKLNNLISKKDLAKTQLDRFGYELKQALPDAVDIRYAVCKDSSGKAPTLSGGTFSSNCDDKANG
DTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE
Nucleotide
Download Length: 609 bp
>NTDB_id=1144348 C7R99_RS03040 WP_106178882.1 517978..518586(+) (pilI) [Neisseria gonorrhoeae strain WHO_Z]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTGGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAAACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACATGGGGTCGTACACCCCCACTTACTCTGGCGGCGATTTCAAGCTTAATAATTTGATAAGCAAGAAGGA
TTTGGCAAAGACCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGATATTCGTTACGCTG
TCTGCAAGGATTCGTCGGGTAAGGCACCGACATTGTCCGGCGGTACTTTTTCTTCAAATTGCGACGATAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGTGAGCGG
CGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTGGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAAACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACATGGGGTCGTACACCCCCACTTACTCTGGCGGCGATTTCAAGCTTAATAATTTGATAAGCAAGAAGGA
TTTGGCAAAGACCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGATATTCGTTACGCTG
TCTGCAAGGATTCGTCGGGTAAGGCACCGACATTGTCCGGCGGTACTTTTTCTTCAAATTGCGACGATAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGTGAGCGG
CGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilI | Neisseria gonorrhoeae MS11 |
93.564 |
100 |
0.936 |
| pilV | Neisseria gonorrhoeae MS11 |
93.564 |
100 |
0.936 |
| pilV | Neisseria meningitidis 8013 |
84.466 |
100 |
0.861 |