Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | BN6763_RS03625 | Genome accession | NZ_LT571449 |
| Coordinates | 699617..700192 (+) | Length | 191 a.a. |
| NCBI ID | WP_001829272.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis isolate BPH0662 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 700593..743171 | 699617..700192 | flank | 401 |
Gene organization within MGE regions
Location: 699617..743171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN6763_RS03625 | comK/comK1 | 699617..700192 (+) | 576 | WP_001829272.1 | competence protein ComK | Regulator |
| BN6763_RS03640 | - | 700593..701642 (-) | 1050 | WP_002504795.1 | tyrosine-type recombinase/integrase | - |
| BN6763_RS03645 | - | 701753..701950 (+) | 198 | WP_002497576.1 | hypothetical protein | - |
| BN6763_RS03650 | - | 701947..702354 (-) | 408 | WP_002497577.1 | TIR domain-containing protein | - |
| BN6763_RS03655 | - | 702348..702785 (-) | 438 | WP_002497578.1 | DUF4231 domain-containing protein | - |
| BN6763_RS03660 | - | 702897..703565 (-) | 669 | WP_002504794.1 | hypothetical protein | - |
| BN6763_RS03665 | - | 703583..704041 (-) | 459 | WP_002504200.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BN6763_RS03670 | - | 704063..704377 (-) | 315 | WP_002504199.1 | helix-turn-helix domain-containing protein | - |
| BN6763_RS03675 | - | 704530..704742 (+) | 213 | WP_002456362.1 | helix-turn-helix transcriptional regulator | - |
| BN6763_RS14375 | - | 704786..704926 (+) | 141 | WP_002485815.1 | hypothetical protein | - |
| BN6763_RS03680 | - | 704919..705143 (-) | 225 | WP_002504198.1 | hypothetical protein | - |
| BN6763_RS03685 | - | 705193..705933 (+) | 741 | WP_002504197.1 | phage repressor protein | - |
| BN6763_RS03690 | - | 705946..706155 (+) | 210 | WP_001830281.1 | hypothetical protein | - |
| BN6763_RS14380 | - | 706169..706315 (+) | 147 | WP_002504793.1 | hypothetical protein | - |
| BN6763_RS03695 | - | 706302..706580 (-) | 279 | WP_002484728.1 | hypothetical protein | - |
| BN6763_RS14385 | - | 706675..706851 (+) | 177 | WP_002484719.1 | hypothetical protein | - |
| BN6763_RS03700 | - | 706913..707164 (+) | 252 | WP_002484751.1 | hypothetical protein | - |
| BN6763_RS03705 | - | 707157..707642 (+) | 486 | WP_002484734.1 | siphovirus Gp157 family protein | - |
| BN6763_RS03710 | - | 707643..708269 (+) | 627 | WP_002469464.1 | DUF1071 domain-containing protein | - |
| BN6763_RS03715 | - | 708262..708678 (+) | 417 | WP_002484754.1 | single-stranded DNA-binding protein | - |
| BN6763_RS03720 | - | 708692..709381 (+) | 690 | WP_002504792.1 | putative HNHc nuclease | - |
| BN6763_RS03725 | - | 709359..709589 (+) | 231 | WP_002504791.1 | helix-turn-helix domain-containing protein | - |
| BN6763_RS03730 | - | 709595..709810 (+) | 216 | WP_002504790.1 | helix-turn-helix domain-containing protein | - |
| BN6763_RS03735 | - | 709797..710525 (+) | 729 | WP_002504789.1 | DnaD domain protein | - |
| BN6763_RS03740 | - | 710531..710884 (+) | 354 | WP_002504788.1 | hypothetical protein | - |
| BN6763_RS03745 | - | 710874..712121 (+) | 1248 | WP_002504787.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| BN6763_RS03750 | - | 712118..712348 (+) | 231 | WP_002504786.1 | hypothetical protein | - |
| BN6763_RS03755 | - | 712317..712541 (+) | 225 | WP_002456377.1 | DUF3269 family protein | - |
| BN6763_RS03760 | - | 712552..712968 (+) | 417 | WP_002504785.1 | DUF1064 domain-containing protein | - |
| BN6763_RS03765 | - | 712955..713329 (+) | 375 | WP_002484718.1 | hypothetical protein | - |
| BN6763_RS03770 | - | 713329..713520 (+) | 192 | WP_002484773.1 | hypothetical protein | - |
| BN6763_RS03775 | - | 713521..713880 (+) | 360 | WP_002484760.1 | SA1788 family PVL leukocidin-associated protein | - |
| BN6763_RS03780 | - | 713877..714329 (+) | 453 | WP_002484724.1 | DUF3310 domain-containing protein | - |
| BN6763_RS03785 | - | 714319..714606 (+) | 288 | WP_002484753.1 | hypothetical protein | - |
| BN6763_RS03790 | - | 714622..715302 (+) | 681 | WP_002504784.1 | hypothetical protein | - |
| BN6763_RS03795 | - | 715299..715499 (+) | 201 | WP_002504783.1 | hypothetical protein | - |
| BN6763_RS03800 | - | 715483..715836 (+) | 354 | WP_002504782.1 | hypothetical protein | - |
| BN6763_RS03805 | - | 715817..716014 (+) | 198 | WP_002504781.1 | Lar family restriction alleviation protein | - |
| BN6763_RS03810 | - | 716015..716542 (+) | 528 | WP_002504780.1 | dUTPase | - |
| BN6763_RS03815 | - | 716704..716862 (+) | 159 | WP_002504779.1 | DUF1381 domain-containing protein | - |
| BN6763_RS03820 | - | 716921..717199 (+) | 279 | WP_002504778.1 | hypothetical protein | - |
| BN6763_RS03825 | rinB | 717192..717359 (+) | 168 | WP_002504777.1 | transcriptional activator RinB | - |
| BN6763_RS03830 | - | 717359..717508 (+) | 150 | WP_002484731.1 | DUF1514 family protein | - |
| BN6763_RS03835 | - | 717525..717971 (+) | 447 | WP_002484732.1 | transcriptional regulator | - |
| BN6763_RS03840 | - | 718566..718916 (+) | 351 | WP_002504776.1 | HNH endonuclease | - |
| BN6763_RS03845 | - | 719059..719529 (+) | 471 | WP_002484733.1 | phage terminase small subunit P27 family | - |
| BN6763_RS03850 | - | 719522..721273 (+) | 1752 | WP_002484749.1 | terminase large subunit | - |
| BN6763_RS03855 | - | 721285..721479 (+) | 195 | WP_002500102.1 | hypothetical protein | - |
| BN6763_RS03860 | - | 721482..722714 (+) | 1233 | WP_002504774.1 | phage portal protein | - |
| BN6763_RS03865 | - | 722704..723261 (+) | 558 | WP_002504773.1 | HK97 family phage prohead protease | - |
| BN6763_RS03870 | - | 723301..724650 (+) | 1350 | WP_002504772.1 | phage major capsid protein | - |
| BN6763_RS03875 | - | 724669..725010 (+) | 342 | WP_002484745.1 | head-tail connector protein | - |
| BN6763_RS03880 | - | 725000..725329 (+) | 330 | WP_002484730.1 | hypothetical protein | - |
| BN6763_RS03885 | - | 725443..725730 (+) | 288 | WP_002484720.1 | hypothetical protein | - |
| BN6763_RS03890 | - | 725733..726137 (+) | 405 | WP_002484722.1 | hypothetical protein | - |
| BN6763_RS03895 | - | 726150..726779 (+) | 630 | WP_002484765.1 | major tail protein | - |
| BN6763_RS03900 | - | 726798..726983 (+) | 186 | WP_002484762.1 | hypothetical protein | - |
| BN6763_RS03905 | gpG | 727047..727409 (+) | 363 | WP_002484709.1 | phage tail assembly chaperone G | - |
| BN6763_RS14690 | gpGT | 727454..727594 (+) | 141 | WP_002484764.1 | phage tail assembly chaperone GT | - |
| BN6763_RS03910 | - | 727623..732179 (+) | 4557 | WP_002504771.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| BN6763_RS03915 | - | 732181..733014 (+) | 834 | WP_002504770.1 | phage tail domain-containing protein | - |
| BN6763_RS03920 | - | 733024..734583 (+) | 1560 | WP_002504769.1 | prophage endopeptidase tail family protein | - |
| BN6763_RS14395 | - | 734576..734749 (+) | 174 | WP_002456411.1 | hypothetical protein | - |
| BN6763_RS03925 | - | 734765..736627 (+) | 1863 | WP_002504768.1 | M14 family metallopeptidase | - |
| BN6763_RS03930 | - | 736627..737841 (+) | 1215 | WP_002504767.1 | BppU family phage baseplate upper protein | - |
| BN6763_RS03935 | - | 737846..738469 (+) | 624 | WP_002504766.1 | poly-gamma-glutamate hydrolase family protein | - |
| BN6763_RS03940 | - | 738466..738891 (+) | 426 | WP_002456415.1 | hypothetical protein | - |
| BN6763_RS03945 | - | 738878..739285 (+) | 408 | WP_002504154.1 | hypothetical protein | - |
| BN6763_RS03950 | - | 739411..739677 (+) | 267 | WP_002504765.1 | phage holin | - |
| BN6763_RS03955 | - | 739677..741059 (+) | 1383 | WP_002504764.1 | N-acetylmuramoyl-L-alanine amidase | - |
| BN6763_RS03960 | - | 741137..742063 (+) | 927 | WP_002504133.1 | hypothetical protein | - |
| BN6763_RS03965 | - | 742256..742783 (+) | 528 | WP_002504240.1 | Panacea domain-containing protein | - |
| BN6763_RS03970 | - | 742773..743171 (+) | 399 | WP_002504241.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22782.87 Da Isoelectric Point: 9.2887
>NTDB_id=1143850 BN6763_RS03625 WP_001829272.1 699617..700192(+) (comK/comK1) [Staphylococcus epidermidis isolate BPH0662]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN
Nucleotide
Download Length: 576 bp
>NTDB_id=1143850 BN6763_RS03625 WP_001829272.1 699617..700192(+) (comK/comK1) [Staphylococcus epidermidis isolate BPH0662]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.757 |
96.859 |
0.743 |
| comK/comK1 | Staphylococcus aureus N315 |
76.757 |
96.859 |
0.743 |