Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/comE2   Type   Regulator
Locus tag   DQN23_RS09535 Genome accession   NZ_LS483403
Coordinates   1581983..1582144 (-) Length   53 a.a.
NCBI ID   WP_313769791.1    Uniprot ID   -
Organism   Streptococcus lutetiensis strain NCTC13774     
Function   activate transcription of early competence genes (predicted from homology)   
Competence regulation

Genomic Context


Location: 1576983..1587144
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQN23_RS07925 (NCTC13774_01662) - 1577295..1578233 (-) 939 WP_020917484.1 3'-5' exoribonuclease YhaM family protein -
  DQN23_RS07930 (NCTC13774_01663) rmuC 1578223..1579497 (-) 1275 WP_020917485.1 DNA recombination protein RmuC -
  DQN23_RS07935 (NCTC13774_01664) - 1579499..1580131 (-) 633 WP_020917486.1 thiamine diphosphokinase -
  DQN23_RS07940 (NCTC13774_01665) rpe 1580124..1580786 (-) 663 WP_020917487.1 ribulose-phosphate 3-epimerase -
  DQN23_RS07945 (NCTC13774_01666) rsgA 1580793..1581665 (-) 873 WP_058832824.1 ribosome small subunit-dependent GTPase A -
  DQN23_RS09535 comE/comE2 1581983..1582144 (-) 162 WP_313769791.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  DQN23_RS09540 (NCTC13774_01668) comE/comE2 1582122..1582502 (-) 381 WP_267895290.1 LytTR family DNA-binding domain-containing protein Regulator
  DQN23_RS09435 (NCTC13774_01669) comE/comE2 1582487..1582714 (-) 228 WP_233422877.1 hypothetical protein Regulator
  DQN23_RS07960 (NCTC13774_01670) comD/comD2 1583272..1584105 (-) 834 WP_111713004.1 sensor histidine kinase Regulator
  DQN23_RS07965 (NCTC13774_01671) - 1585001..1585294 (-) 294 WP_020917489.1 bacteriocin immunity protein -
  DQN23_RS07970 (NCTC13774_01672) - 1585322..1585627 (-) 306 WP_020917490.1 bacteriocin immunity protein -
  DQN23_RS07975 - 1585640..1585789 (-) 150 WP_020917491.1 hypothetical protein -
  DQN23_RS07980 (NCTC13774_01673) rsmA 1586196..1587068 (-) 873 WP_021143191.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -

Sequence


Protein


Download         Length: 53 a.a.        Molecular weight: 6433.51 Da        Isoelectric Point: 9.7124

>NTDB_id=1140375 DQN23_RS09535 WP_313769791.1 1581983..1582144(-) (comE/comE2) [Streptococcus lutetiensis strain NCTC13774]
MRNYLDVKSYLINLNNIVRLDKKEGLVYFDDDKACYVSRKYIKDLRSKMENLK

Nucleotide


Download         Length: 162 bp        

>NTDB_id=1140375 DQN23_RS09535 WP_313769791.1 1581983..1582144(-) (comE/comE2) [Streptococcus lutetiensis strain NCTC13774]
ATCAGAAATTATTTAGATGTTAAATCATATCTGATTAACCTAAATAATATTGTTAGGTTAGATAAAAAAGAAGGTTTGGT
TTATTTTGACGATGATAAAGCTTGTTATGTTTCTAGAAAATATATCAAAGACTTAAGGTCAAAAATGGAAAATCTGAAAT
AG

Domains


Predicted by InterproScan.

(8-49)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/comE2 Streptococcus equinus JB1

100

86.792

0.868


Multiple sequence alignment