Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   BKMNNEJI_RS13900 Genome accession   NZ_LR822061
Coordinates   2780315..2780758 (+) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus isolate HU-14     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2771295..2816241 2780315..2780758 within 0


Gene organization within MGE regions


Location: 2771295..2816241
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKMNNEJI_RS13825 (LJDFIFNA_02645) - 2771295..2771960 (+) 666 WP_001024095.1 SDR family oxidoreductase -
  BKMNNEJI_RS13830 (LJDFIFNA_02646) - 2772477..2773862 (-) 1386 WP_000861310.1 recombinase family protein -
  BKMNNEJI_RS13835 (LJDFIFNA_02647) - 2774069..2774749 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  BKMNNEJI_RS13840 (LJDFIFNA_02648) - 2774781..2775506 (-) 726 WP_000661437.1 PH domain-containing protein -
  BKMNNEJI_RS13845 (LJDFIFNA_02649) - 2775534..2776208 (-) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  BKMNNEJI_RS13850 (LJDFIFNA_02650) - 2776225..2776557 (-) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  BKMNNEJI_RS13855 (LJDFIFNA_02651) - 2776820..2777014 (+) 195 WP_000108122.1 helix-turn-helix domain-containing protein -
  BKMNNEJI_RS13860 (LJDFIFNA_02652) - 2777014..2777778 (+) 765 WP_001002760.1 phage antirepressor Ant -
  BKMNNEJI_RS13865 (LJDFIFNA_02653) - 2777795..2777989 (+) 195 WP_000390104.1 hypothetical protein -
  BKMNNEJI_RS13870 (LJDFIFNA_02654) - 2778042..2778218 (+) 177 WP_001094935.1 hypothetical protein -
  BKMNNEJI_RS13875 (LJDFIFNA_02655) - 2778193..2778423 (-) 231 WP_000395457.1 hypothetical protein -
  BKMNNEJI_RS15270 (LJDFIFNA_02656) - 2778482..2778610 (+) 129 WP_001559112.1 hypothetical protein -
  BKMNNEJI_RS13880 (LJDFIFNA_02657) - 2778603..2778764 (+) 162 WP_000066028.1 DUF1270 family protein -
  BKMNNEJI_RS13885 (LJDFIFNA_02658) - 2778858..2779118 (+) 261 WP_000291084.1 DUF1108 family protein -
  BKMNNEJI_RS13890 (LJDFIFNA_02659) - 2779131..2779667 (+) 537 WP_001004333.1 host-nuclease inhibitor Gam family protein -
  BKMNNEJI_RS13895 (LJDFIFNA_02660) - 2779668..2780318 (+) 651 WP_000840496.1 ERF family protein -
  BKMNNEJI_RS13900 (LJDFIFNA_02661) ssbA 2780315..2780758 (+) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  BKMNNEJI_RS13905 (LJDFIFNA_02662) - 2780770..2781444 (+) 675 WP_000057263.1 putative HNHc nuclease -
  BKMNNEJI_RS13910 (LJDFIFNA_02663) - 2781441..2781590 (+) 150 WP_001081076.1 hypothetical protein -
  BKMNNEJI_RS13915 (LJDFIFNA_02664) - 2781583..2781864 (-) 282 WP_000414755.1 hypothetical protein -
  BKMNNEJI_RS13920 (LJDFIFNA_02665) - 2781930..2782700 (+) 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
  BKMNNEJI_RS13925 (LJDFIFNA_02666) - 2782710..2783489 (+) 780 WP_000803062.1 ATP-binding protein -
  BKMNNEJI_RS13930 (LJDFIFNA_02667) - 2783483..2783641 (+) 159 WP_000256589.1 hypothetical protein -
  BKMNNEJI_RS13935 (LJDFIFNA_02668) - 2783654..2783875 (+) 222 WP_001123695.1 DUF3269 family protein -
  BKMNNEJI_RS13940 (LJDFIFNA_02669) - 2783885..2784289 (+) 405 WP_000049793.1 DUF1064 domain-containing protein -
  BKMNNEJI_RS13945 (LJDFIFNA_02670) - 2784294..2784479 (+) 186 WP_001187243.1 DUF3113 family protein -
  BKMNNEJI_RS13950 (LJDFIFNA_02671) - 2784480..2784785 (+) 306 WP_000101252.1 hypothetical protein -
  BKMNNEJI_RS13955 (LJDFIFNA_02672) - 2784913..2785269 (+) 357 WP_000029376.1 SA1788 family PVL leukocidin-associated protein -
  BKMNNEJI_RS13960 (LJDFIFNA_02673) - 2785273..2785515 (+) 243 WP_000131389.1 SAV1978 family virulence-associated passenger protein -
  BKMNNEJI_RS13965 (LJDFIFNA_02674) - 2785529..2785735 (+) 207 WP_000693987.1 hypothetical protein -
  BKMNNEJI_RS13970 (LJDFIFNA_02675) - 2785738..2786139 (+) 402 WP_000695759.1 hypothetical protein -
  BKMNNEJI_RS13975 (LJDFIFNA_02676) - 2786136..2786483 (+) 348 WP_000979209.1 YopX family protein -
  BKMNNEJI_RS13980 (LJDFIFNA_02677) - 2786480..2786788 (+) 309 WP_000144708.1 hypothetical protein -
  BKMNNEJI_RS13985 (LJDFIFNA_02678) - 2786781..2787017 (+) 237 WP_001065079.1 DUF1024 family protein -
  BKMNNEJI_RS13990 (LJDFIFNA_02679) - 2787022..2787204 (+) 183 WP_000028421.1 hypothetical protein -
  BKMNNEJI_RS13995 (LJDFIFNA_02680) - 2787197..2787727 (+) 531 WP_000185651.1 dUTP diphosphatase -
  BKMNNEJI_RS14000 (LJDFIFNA_02681) - 2787764..2787970 (+) 207 WP_000195785.1 DUF1381 domain-containing protein -
  BKMNNEJI_RS14005 (LJDFIFNA_02682) - 2787967..2788161 (+) 195 WP_000132920.1 hypothetical protein -
  BKMNNEJI_RS14010 (LJDFIFNA_02683) - 2788158..2788361 (+) 204 WP_001072797.1 hypothetical protein -
  BKMNNEJI_RS14015 (LJDFIFNA_02684) rinB 2788354..2788527 (+) 174 WP_001657250.1 transcriptional activator RinB -
  BKMNNEJI_RS14020 (LJDFIFNA_02685) - 2788528..2788674 (+) 147 WP_000990005.1 hypothetical protein -
  BKMNNEJI_RS14025 (LJDFIFNA_02686) - 2788698..2789120 (+) 423 WP_000162701.1 RinA family phage transcriptional activator -
  BKMNNEJI_RS14030 (LJDFIFNA_02687) - 2789308..2789802 (+) 495 WP_001038244.1 terminase small subunit -
  BKMNNEJI_RS14035 (LJDFIFNA_02688) - 2789805..2791100 (+) 1296 WP_000273011.1 PBSX family phage terminase large subunit -
  BKMNNEJI_RS14040 (LJDFIFNA_02689) - 2791111..2792649 (+) 1539 WP_000909971.1 phage portal protein -
  BKMNNEJI_RS14045 (LJDFIFNA_02690) - 2792656..2793651 (+) 996 WP_001668926.1 minor capsid protein -
  BKMNNEJI_RS14050 (LJDFIFNA_02691) - 2793724..2793894 (+) 171 WP_000072202.1 hypothetical protein -
  BKMNNEJI_RS15225 - 2793922..2794009 (+) 88 Protein_2746 hypothetical protein -
  BKMNNEJI_RS14055 (LJDFIFNA_02692) - 2794003..2794623 (+) 621 WP_000392142.1 DUF4355 domain-containing protein -
  BKMNNEJI_RS14060 (LJDFIFNA_02693) - 2794637..2795611 (+) 975 WP_000438500.1 phage major capsid protein -
  BKMNNEJI_RS14065 (LJDFIFNA_02694) - 2795633..2795920 (+) 288 WP_001114089.1 hypothetical protein -
  BKMNNEJI_RS14070 (LJDFIFNA_02695) - 2795929..2796261 (+) 333 WP_000208960.1 phage head-tail connector protein -
  BKMNNEJI_RS14075 (LJDFIFNA_02696) - 2796258..2796560 (+) 303 WP_001268309.1 hypothetical protein -
  BKMNNEJI_RS14080 (LJDFIFNA_02697) - 2796560..2796907 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  BKMNNEJI_RS14085 (LJDFIFNA_02699) - 2796919..2797303 (+) 385 Protein_2753 hypothetical protein -
  BKMNNEJI_RS14090 (LJDFIFNA_02700) - 2797322..2797903 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  BKMNNEJI_RS14095 (LJDFIFNA_02701) - 2797965..2798330 (+) 366 WP_001100161.1 tail assembly chaperone -
  BKMNNEJI_RS14100 (LJDFIFNA_02702) - 2798360..2798704 (+) 345 WP_000105584.1 hypothetical protein -
  BKMNNEJI_RS14105 (LJDFIFNA_02703) - 2798721..2802185 (+) 3465 WP_000141455.1 hypothetical protein -
  BKMNNEJI_RS14110 (LJDFIFNA_02704) - 2802198..2803145 (+) 948 WP_000350670.1 phage tail family protein -
  BKMNNEJI_RS14115 (LJDFIFNA_02705) - 2803154..2805055 (+) 1902 WP_031873673.1 SGNH/GDSL hydrolase family protein -
  BKMNNEJI_RS14120 (LJDFIFNA_02706) - 2805070..2806980 (+) 1911 WP_000369016.1 hypothetical protein -
  BKMNNEJI_RS14125 (LJDFIFNA_02707) - 2806980..2808803 (+) 1824 WP_000259632.1 phage baseplate upper protein -
  BKMNNEJI_RS14130 (LJDFIFNA_02708) - 2808803..2809180 (+) 378 WP_000705894.1 DUF2977 domain-containing protein -
  BKMNNEJI_RS14135 (LJDFIFNA_02709) - 2809190..2809363 (+) 174 WP_001790193.1 XkdX family protein -
  BKMNNEJI_RS14140 (LJDFIFNA_02710) - 2809404..2809703 (+) 300 WP_000466778.1 DUF2951 domain-containing protein -
  BKMNNEJI_RS14145 (LJDFIFNA_02711) - 2809840..2811738 (+) 1899 WP_000524023.1 glucosaminidase domain-containing protein -
  BKMNNEJI_RS14150 (LJDFIFNA_02712) - 2811751..2812989 (+) 1239 WP_000276637.1 BppU family phage baseplate upper protein -
  BKMNNEJI_RS14155 (LJDFIFNA_02713) - 2812994..2813389 (+) 396 WP_000387943.1 hypothetical protein -
  BKMNNEJI_RS14160 (LJDFIFNA_02714) - 2813444..2813881 (+) 438 WP_000354128.1 phage holin -
  BKMNNEJI_RS14165 (LJDFIFNA_02715) - 2813862..2814470 (+) 609 Protein_2769 CHAP domain-containing protein -
  BKMNNEJI_RS14170 (LJDFIFNA_02716) - 2814533..2815078 (+) 546 WP_000136401.1 NUMOD4 motif-containing HNH endonuclease -
  BKMNNEJI_RS14175 (LJDFIFNA_02717) - 2815390..2816241 (+) 852 Protein_2771 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=1132296 BKMNNEJI_RS13900 WP_001099009.1 2780315..2780758(+) (ssbA) [Staphylococcus aureus isolate HU-14]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=1132296 BKMNNEJI_RS13900 WP_001099009.1 2780315..2780758(+) (ssbA) [Staphylococcus aureus isolate HU-14]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442


Multiple sequence alignment