Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiD   Type   Regulator
Locus tag   H1W86_RS06605 Genome accession   NZ_LR822042
Coordinates   1273765..1274691 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_1358     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1256218..1327509 1273765..1274691 within 0


Gene organization within MGE regions


Location: 1256218..1327509
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W86_RS06520 (STHERMO_1431) liaF 1256226..1256924 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  H1W86_RS09785 (STHERMO_1432) - 1257179..1257346 (-) 168 WP_014608530.1 potassium channel family protein -
  H1W86_RS06530 (STHERMO_1435) stkP/pknB 1257983..1259854 (-) 1872 WP_014621795.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  H1W86_RS06535 (STHERMO_1436) - 1259854..1260591 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  H1W86_RS06540 (STHERMO_1437) rsmB 1260635..1261957 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  H1W86_RS06545 (STHERMO_1438) fmt 1261947..1262882 (-) 936 WP_014608534.1 methionyl-tRNA formyltransferase -
  H1W86_RS06550 (STHERMO_1439) - 1262900..1265296 (-) 2397 WP_134973349.1 primosomal protein N' -
  H1W86_RS06555 (STHERMO_1440) rpoZ 1265438..1265752 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  H1W86_RS06560 (STHERMO_1441) gmk 1265774..1266403 (-) 630 WP_180479475.1 guanylate kinase -
  H1W86_RS06565 (STHERMO_1442) ftsY 1266629..1268020 (-) 1392 WP_180479477.1 signal recognition particle-docking protein FtsY -
  H1W86_RS06570 (STHERMO_1443) - 1268034..1268849 (-) 816 WP_180473278.1 Cof-type HAD-IIB family hydrolase -
  H1W86_RS06575 (STHERMO_1444) - 1268842..1269636 (-) 795 WP_180479479.1 HAD-IIB family hydrolase -
  H1W86_RS06580 (STHERMO_1445) - 1269821..1270198 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  H1W86_RS06585 (STHERMO_1446) - 1270203..1270901 (+) 699 WP_180479481.1 ABC transporter ATP-binding protein -
  H1W86_RS06590 (STHERMO_1447) - 1270913..1271698 (+) 786 WP_180479483.1 ABC transporter permease -
  H1W86_RS06595 (STHERMO_1448) amiF 1271748..1272677 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  H1W86_RS06600 (STHERMO_1449) amiE 1272670..1273755 (-) 1086 WP_180479485.1 ABC transporter ATP-binding protein Regulator
  H1W86_RS06605 (STHERMO_1450) amiD 1273765..1274691 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  H1W86_RS06610 (STHERMO_1451) amiC 1274691..1276184 (-) 1494 WP_180479487.1 ABC transporter permease Regulator
  H1W86_RS06615 (STHERMO_1452) amiA 1276246..1278213 (-) 1968 WP_180479489.1 peptide ABC transporter substrate-binding protein Regulator
  H1W86_RS09420 (STHERMO_1453) - 1278569..1279746 (+) 1178 Protein_1265 ISL3 family transposase -
  H1W86_RS06625 (STHERMO_1454) amiA3 1279791..1281764 (-) 1974 WP_180479491.1 peptide ABC transporter substrate-binding protein Regulator
  H1W86_RS06630 (STHERMO_1456) - 1282069..1283216 (+) 1148 WP_180479467.1 IS3 family transposase -
  H1W86_RS06635 - 1283254..1283438 (-) 185 Protein_1268 IS3 family transposase -
  H1W86_RS09790 - 1283432..1283842 (-) 411 Protein_1269 ATP-binding cassette domain-containing protein -
  H1W86_RS06650 (STHERMO_1459) - 1283869..1284189 (-) 321 Protein_1270 TatD family hydrolase -
  H1W86_RS06655 (STHERMO_1460) - 1284536..1285741 (+) 1206 WP_011681420.1 OFA family MFS transporter -
  H1W86_RS06660 - 1285787..1287100 (-) 1314 Protein_1272 IS3 family transposase -
  H1W86_RS06665 (STHERMO_1465) pta 1287225..1288208 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  H1W86_RS06670 (STHERMO_1466) - 1288222..1289118 (-) 897 WP_179970626.1 RluA family pseudouridine synthase -
  H1W86_RS06675 (STHERMO_1467) - 1289115..1289951 (-) 837 WP_041827075.1 NAD kinase -
  H1W86_RS06680 (STHERMO_1468) - 1289923..1290597 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  H1W86_RS06685 (STHERMO_1469) - 1290693..1291268 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  H1W86_RS06690 (STHERMO_1470) - 1291633..1292604 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  H1W86_RS06695 (STHERMO_1471) - 1292608..1293720 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  H1W86_RS06700 (STHERMO_1472) - 1293722..1294069 (+) 348 WP_011226321.1 DUF1831 domain-containing protein -
  H1W86_RS06705 (STHERMO_1473) - 1294214..1294873 (+) 660 WP_014608556.1 redox-sensing transcriptional repressor Rex -
  H1W86_RS06710 (STHERMO_1474) - 1294866..1295561 (+) 696 WP_014608557.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  H1W86_RS06715 (STHERMO_1475) radC 1295614..1296300 (-) 687 WP_011226324.1 RadC family protein -
  H1W86_RS06720 (STHERMO_1476) - 1296349..1298133 (-) 1785 WP_014727631.1 rhamnan synthesis F family protein -
  H1W86_RS06725 (STHERMO_1477) - 1298130..1299185 (-) 1056 WP_002948022.1 glycosyltransferase family 2 protein -
  H1W86_RS06730 (STHERMO_1478) - 1299205..1300410 (-) 1206 WP_014727633.1 ABC transporter ATP-binding protein -
  H1W86_RS06735 (STHERMO_1479) - 1300410..1301219 (-) 810 WP_002948020.1 ABC transporter permease -
  H1W86_RS06740 (STHERMO_1480) - 1301203..1302159 (-) 957 WP_014727634.1 glycosyltransferase family 2 protein -
  H1W86_RS06745 (STHERMO_1481) cps2T 1302156..1303304 (-) 1149 WP_002948014.1 beta 1-4 rhamnosyltransferase Cps2T -
  H1W86_RS06750 (STHERMO_1482) - 1303413..1304423 (-) 1011 WP_011226330.1 glycosyltransferase family 2 protein -
  H1W86_RS06755 (STHERMO_1483) - 1304420..1305697 (-) 1278 WP_014727635.1 lipopolysaccharide biosynthesis protein -
  H1W86_RS06760 (STHERMO_1484) - 1305690..1306022 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  H1W86_RS06765 (STHERMO_1485) - 1306028..1306723 (-) 696 WP_171073564.1 glycosyltransferase family 2 protein -
  H1W86_RS06770 (STHERMO_1486) rfbD 1306800..1307651 (-) 852 WP_014727637.1 dTDP-4-dehydrorhamnose reductase -
  H1W86_RS06775 (STHERMO_1487) - 1307728..1309062 (-) 1335 WP_180479493.1 DUF6056 family protein -
  H1W86_RS06780 (STHERMO_1488) - 1309175..1310092 (-) 918 WP_002946425.1 glycosyltransferase family 2 protein -
  H1W86_RS06785 (STHERMO_1489) - 1310155..1311570 (-) 1416 WP_014727640.1 DUF2142 domain-containing protein -
  H1W86_RS06790 (STHERMO_1491) - 1311904..1312239 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  H1W86_RS06795 (STHERMO_1492) rpoD 1312293..1313402 (-) 1110 WP_180479495.1 RNA polymerase sigma factor RpoD -
  H1W86_RS06800 (STHERMO_1493) dnaG 1313406..1315217 (-) 1812 WP_116920323.1 DNA primase -
  H1W86_RS06805 (STHERMO_1494) rpsU 1315588..1315764 (-) 177 WP_082309068.1 30S ribosomal protein S21 -
  H1W86_RS06810 (STHERMO_1495) - 1315959..1316753 (-) 795 WP_023909836.1 ABC transporter substrate-binding protein -
  H1W86_RS06815 (STHERMO_1496) - 1316846..1317955 (-) 1110 WP_180479732.1 aminotransferase -
  H1W86_RS06820 (STHERMO_1497) - 1318302..1319099 (-) 798 WP_082309071.1 transporter substrate-binding domain-containing protein -
  H1W86_RS06825 (STHERMO_1498) - 1319096..1319926 (-) 831 WP_022097022.1 transporter substrate-binding domain-containing protein -
  H1W86_RS06830 (STHERMO_1499) - 1320140..1320604 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  H1W86_RS06835 (STHERMO_1500) uvrB 1320649..1322640 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  H1W86_RS06840 - 1323327..1324263 (-) 937 Protein_1308 CPBP family intramembrane glutamic endopeptidase -
  H1W86_RS06845 (STHERMO_1505) - 1324461..1326671 (+) 2211 WP_179970611.1 ABC transporter substrate-binding protein/permease -
  H1W86_RS06850 (STHERMO_1506) - 1326671..1327411 (+) 741 WP_011681459.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=1132130 H1W86_RS06605 WP_002946409.1 1273765..1274691(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1358]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=1132130 H1W86_RS06605 WP_002946409.1 1273765..1274691(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1358]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1

  amiD Streptococcus thermophilus LMD-9

100

100

1

  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964


Multiple sequence alignment