Detailed information
Overview
| Name | amiD | Type | Regulator |
| Locus tag | H1W87_RS06665 | Genome accession | NZ_LR822037 |
| Coordinates | 1274676..1275602 (-) | Length | 308 a.a. |
| NCBI ID | WP_002946409.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1121 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1257123..1327202 | 1274676..1275602 | within | 0 |
Gene organization within MGE regions
Location: 1257123..1327202
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W87_RS06580 (STHERMO_1466) | liaF | 1257131..1257829 (-) | 699 | WP_011226289.1 | cell wall-active antibiotics response protein LiaF | - |
| H1W87_RS09765 (STHERMO_1467) | - | 1258084..1258251 (-) | 168 | WP_232088837.1 | potassium channel family protein | - |
| H1W87_RS06590 (STHERMO_1470) | stkP/pknB | 1258888..1260759 (-) | 1872 | WP_180478115.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| H1W87_RS06595 (STHERMO_1471) | - | 1260759..1261496 (-) | 738 | WP_180478117.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| H1W87_RS06600 (STHERMO_1472) | rsmB | 1261540..1262862 (-) | 1323 | WP_014608533.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| H1W87_RS06605 (STHERMO_1473) | fmt | 1262852..1263787 (-) | 936 | WP_002951411.1 | methionyl-tRNA formyltransferase | - |
| H1W87_RS06610 (STHERMO_1474) | - | 1263805..1266201 (-) | 2397 | WP_180478119.1 | primosomal protein N' | - |
| H1W87_RS06615 (STHERMO_1475) | rpoZ | 1266343..1266657 (-) | 315 | WP_002951415.1 | DNA-directed RNA polymerase subunit omega | - |
| H1W87_RS06620 (STHERMO_1476) | gmk | 1266679..1267308 (-) | 630 | WP_022096878.1 | guanylate kinase | - |
| H1W87_RS06625 (STHERMO_1477) | ftsY | 1267541..1268932 (-) | 1392 | WP_180478121.1 | signal recognition particle-docking protein FtsY | - |
| H1W87_RS06630 (STHERMO_1478) | - | 1268946..1269761 (-) | 816 | WP_024010001.1 | Cof-type HAD-IIB family hydrolase | - |
| H1W87_RS06635 (STHERMO_1479) | - | 1269754..1270548 (-) | 795 | WP_180478123.1 | HAD-IIB family hydrolase | - |
| H1W87_RS06640 (STHERMO_1481) | - | 1270732..1271109 (+) | 378 | WP_011226300.1 | GntR family transcriptional regulator | - |
| H1W87_RS06645 (STHERMO_1482) | - | 1271114..1271812 (+) | 699 | WP_011226301.1 | ABC transporter ATP-binding protein | - |
| H1W87_RS06650 (STHERMO_1483) | - | 1271824..1272609 (+) | 786 | WP_002951425.1 | hypothetical protein | - |
| H1W87_RS06655 (STHERMO_1484) | amiF | 1272659..1273588 (-) | 930 | WP_002951426.1 | ATP-binding cassette domain-containing protein | Regulator |
| H1W87_RS06660 (STHERMO_1485) | amiE | 1273581..1274666 (-) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| H1W87_RS06665 (STHERMO_1486) | amiD | 1274676..1275602 (-) | 927 | WP_002946409.1 | oligopeptide ABC transporter permease OppC | Regulator |
| H1W87_RS06670 (STHERMO_1487) | amiC | 1275602..1277095 (-) | 1494 | WP_002946410.1 | ABC transporter permease | Regulator |
| H1W87_RS06675 | - | 1277157..1279123 (-) | 1967 | Protein_1261 | peptide ABC transporter substrate-binding protein | - |
| H1W87_RS09370 (STHERMO_1490) | - | 1279479..1280710 (+) | 1232 | Protein_1262 | ISL3 family transposase | - |
| H1W87_RS06685 (STHERMO_1491) | amiA3 | 1280755..1282728 (-) | 1974 | WP_011226306.1 | peptide ABC transporter substrate-binding protein | Regulator |
| H1W87_RS06690 | - | 1282932..1283122 (-) | 191 | Protein_1264 | IS3 family transposase | - |
| H1W87_RS09770 | - | 1283116..1283526 (-) | 411 | Protein_1265 | ATP-binding cassette domain-containing protein | - |
| H1W87_RS06705 (STHERMO_1494) | - | 1283558..1283872 (-) | 315 | Protein_1266 | TatD family hydrolase | - |
| H1W87_RS06710 (STHERMO_1495) | - | 1284219..1285424 (+) | 1206 | WP_011227415.1 | OFA family MFS transporter | - |
| H1W87_RS06715 | - | 1285471..1286824 (-) | 1354 | Protein_1268 | IS3 family transposase | - |
| H1W87_RS06720 (STHERMO_1501) | pta | 1286910..1287893 (-) | 984 | WP_011227420.1 | phosphate acetyltransferase | - |
| H1W87_RS06725 (STHERMO_1502) | - | 1287903..1288802 (-) | 900 | WP_180478127.1 | RluA family pseudouridine synthase | - |
| H1W87_RS06730 (STHERMO_1503) | - | 1288799..1289635 (-) | 837 | WP_096811572.1 | NAD kinase | - |
| H1W87_RS06735 (STHERMO_1504) | - | 1289607..1290281 (-) | 675 | WP_002951443.1 | GTP pyrophosphokinase family protein | - |
| H1W87_RS06740 (STHERMO_1505) | - | 1290377..1290952 (+) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| H1W87_RS06745 (STHERMO_1507) | - | 1291317..1292288 (+) | 972 | WP_002951446.1 | ribose-phosphate diphosphokinase | - |
| H1W87_RS06750 (STHERMO_1508) | - | 1292292..1293404 (+) | 1113 | WP_180478129.1 | cysteine desulfurase family protein | - |
| H1W87_RS06755 (STHERMO_1509) | - | 1293406..1293753 (+) | 348 | WP_014608555.1 | DUF1831 domain-containing protein | - |
| H1W87_RS06760 (STHERMO_1510) | - | 1293897..1294556 (+) | 660 | WP_173940607.1 | redox-sensing transcriptional repressor Rex | - |
| H1W87_RS06765 (STHERMO_1511) | - | 1294549..1295244 (+) | 696 | WP_002951449.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| H1W87_RS06770 (STHERMO_1512) | radC | 1295297..1295983 (-) | 687 | WP_180478131.1 | RadC family protein | - |
| H1W87_RS06775 (STHERMO_1513) | - | 1296032..1297816 (-) | 1785 | WP_011226325.1 | rhamnan synthesis F family protein | - |
| H1W87_RS06780 (STHERMO_1514) | - | 1297813..1298868 (-) | 1056 | WP_096811576.1 | glycosyltransferase family 2 protein | - |
| H1W87_RS06785 (STHERMO_1515) | - | 1298888..1300093 (-) | 1206 | WP_014727633.1 | ABC transporter ATP-binding protein | - |
| H1W87_RS06790 (STHERMO_1516) | - | 1300093..1300902 (-) | 810 | WP_002948020.1 | ABC transporter permease | - |
| H1W87_RS06795 (STHERMO_1517) | - | 1300886..1301842 (-) | 957 | WP_011226328.1 | glycosyltransferase family 2 protein | - |
| H1W87_RS06800 (STHERMO_1518) | cps2T | 1301839..1302987 (-) | 1149 | WP_180478133.1 | beta 1-4 rhamnosyltransferase Cps2T | - |
| H1W87_RS06805 (STHERMO_1519) | - | 1303096..1304106 (-) | 1011 | WP_011226330.1 | glycosyltransferase family 2 protein | - |
| H1W87_RS06810 (STHERMO_1520) | - | 1304103..1305380 (-) | 1278 | WP_180478136.1 | lipopolysaccharide biosynthesis protein | - |
| H1W87_RS06815 (STHERMO_1521) | - | 1305373..1305705 (-) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| H1W87_RS06820 (STHERMO_1522) | - | 1305711..1306406 (-) | 696 | WP_171073564.1 | glycosyltransferase family 2 protein | - |
| H1W87_RS06825 (STHERMO_1523) | rfbD | 1306483..1307334 (-) | 852 | WP_014621820.1 | dTDP-4-dehydrorhamnose reductase | - |
| H1W87_RS06830 (STHERMO_1524) | - | 1307411..1308745 (-) | 1335 | WP_002946422.1 | DUF6056 family protein | - |
| H1W87_RS06835 (STHERMO_1525) | - | 1308858..1309775 (-) | 918 | WP_375708554.1 | glycosyltransferase family 2 protein | - |
| H1W87_RS06840 (STHERMO_1526) | - | 1309838..1311253 (-) | 1416 | WP_096811580.1 | DUF2142 domain-containing protein | - |
| H1W87_RS06845 (STHERMO_1528) | - | 1311587..1311922 (-) | 336 | WP_002891474.1 | metal-sulfur cluster assembly factor | - |
| H1W87_RS06850 (STHERMO_1529) | rpoD | 1311976..1313085 (-) | 1110 | WP_011226338.1 | RNA polymerase sigma factor RpoD | - |
| H1W87_RS06855 (STHERMO_1530) | dnaG | 1313089..1314900 (-) | 1812 | WP_011681448.1 | DNA primase | - |
| H1W87_RS06860 (STHERMO_1531) | mscL | 1315041..1315124 (+) | 84 | Protein_1297 | large conductance mechanosensitive channel protein MscL | - |
| H1W87_RS06865 (STHERMO_1532) | rpsU | 1315284..1315460 (-) | 177 | WP_082309068.1 | 30S ribosomal protein S21 | - |
| H1W87_RS06870 (STHERMO_1533) | - | 1315655..1316449 (-) | 795 | WP_023909836.1 | ABC transporter substrate-binding protein | - |
| H1W87_RS06875 (STHERMO_1534) | - | 1316542..1317651 (-) | 1110 | WP_041828295.1 | aminotransferase | - |
| H1W87_RS06880 (STHERMO_1535) | - | 1317998..1318795 (-) | 798 | WP_179966739.1 | transporter substrate-binding domain-containing protein | - |
| H1W87_RS06885 (STHERMO_1536) | - | 1318792..1319619 (-) | 828 | WP_180478138.1 | transporter substrate-binding domain-containing protein | - |
| H1W87_RS06890 (STHERMO_1537) | - | 1319832..1320296 (-) | 465 | WP_011226345.1 | 8-oxo-dGTP diphosphatase | - |
| H1W87_RS06895 (STHERMO_1538) | uvrB | 1320341..1322332 (-) | 1992 | WP_180478140.1 | excinuclease ABC subunit UvrB | - |
| H1W87_RS06905 | - | 1323019..1323955 (-) | 937 | Protein_1305 | CPBP family intramembrane glutamic endopeptidase | - |
| H1W87_RS06910 (STHERMO_1543) | - | 1324154..1326364 (+) | 2211 | WP_180478144.1 | ABC transporter substrate-binding protein/permease | - |
| H1W87_RS06915 (STHERMO_1544) | - | 1326364..1327104 (+) | 741 | WP_002945131.1 | amino acid ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 308 a.a. Molecular weight: 34694.85 Da Isoelectric Point: 9.7054
>NTDB_id=1131894 H1W87_RS06665 WP_002946409.1 1274676..1275602(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1121]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
Nucleotide
Download Length: 927 bp
>NTDB_id=1131894 H1W87_RS06665 WP_002946409.1 1274676..1275602(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1121]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCTATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCTATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiD | Streptococcus thermophilus LMG 18311 |
100 |
100 |
1 |
| amiD | Streptococcus thermophilus LMD-9 |
100 |
100 |
1 |
| amiD | Streptococcus salivarius strain HSISS4 |
96.429 |
100 |
0.964 |