Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiD   Type   Regulator
Locus tag   H0501_RS06845 Genome accession   NZ_LR822008
Coordinates   1324971..1325897 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_18     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1307425..1385156 1324971..1325897 within 0


Gene organization within MGE regions


Location: 1307425..1385156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0501_RS06760 (STHERMO_1496) liaF 1307433..1308131 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  H0501_RS10085 (STHERMO_1497) - 1308386..1308553 (-) 168 WP_014608530.1 potassium channel family protein -
  H0501_RS06770 (STHERMO_1500) stkP/pknB 1309190..1311061 (-) 1872 WP_014621795.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  H0501_RS06775 (STHERMO_1501) - 1311061..1311798 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  H0501_RS06780 (STHERMO_1502) rsmB 1311842..1313164 (-) 1323 WP_179970630.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  H0501_RS06785 (STHERMO_1503) fmt 1313154..1314089 (-) 936 WP_014608534.1 methionyl-tRNA formyltransferase -
  H0501_RS06790 (STHERMO_1504) - 1314107..1316503 (-) 2397 WP_014608535.1 primosomal protein N' -
  H0501_RS06795 (STHERMO_1505) rpoZ 1316645..1316959 (-) 315 WP_179970629.1 DNA-directed RNA polymerase subunit omega -
  H0501_RS06800 (STHERMO_1506) gmk 1316981..1317610 (-) 630 WP_014608537.1 guanylate kinase -
  H0501_RS06805 (STHERMO_1507) ftsY 1317836..1319227 (-) 1392 WP_014608538.1 signal recognition particle-docking protein FtsY -
  H0501_RS06810 (STHERMO_1508) - 1319241..1320056 (-) 816 WP_011226298.1 Cof-type HAD-IIB family hydrolase -
  H0501_RS06815 (STHERMO_1509) - 1320049..1320843 (-) 795 WP_011681412.1 HAD-IIB family hydrolase -
  H0501_RS06820 (STHERMO_1510) - 1321027..1321404 (+) 378 WP_011681413.1 GntR family transcriptional regulator -
  H0501_RS06825 (STHERMO_1511) - 1321409..1322107 (+) 699 WP_014608540.1 ABC transporter ATP-binding protein -
  H0501_RS06830 (STHERMO_1512) - 1322119..1322904 (+) 786 WP_002951425.1 hypothetical protein -
  H0501_RS06835 (STHERMO_1513) amiF 1322954..1323883 (-) 930 WP_011681415.1 ATP-binding cassette domain-containing protein Regulator
  H0501_RS06840 (STHERMO_1514) amiE 1323876..1324961 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  H0501_RS06845 (STHERMO_1515) amiD 1324971..1325897 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  H0501_RS06850 (STHERMO_1516) amiC 1325897..1327390 (-) 1494 WP_179970628.1 ABC transporter permease Regulator
  H0501_RS06855 (STHERMO_1517) amiA3 1327451..1329418 (-) 1968 WP_179970627.1 peptide ABC transporter substrate-binding protein Regulator
  H0501_RS06860 (STHERMO_1519) - 1329724..1330871 (+) 1148 WP_095559415.1 IS3 family transposase -
  H0501_RS06865 - 1330909..1331093 (-) 185 Protein_1314 IS3 family transposase -
  H0501_RS10090 - 1331087..1331497 (-) 411 Protein_1315 ATP-binding cassette domain-containing protein -
  H0501_RS06880 (STHERMO_1522) - 1331529..1331843 (-) 315 Protein_1316 TatD family hydrolase -
  H0501_RS06885 (STHERMO_1523) - 1332192..1333397 (+) 1206 WP_011681420.1 OFA family MFS transporter -
  H0501_RS06890 - 1333443..1334756 (-) 1314 Protein_1318 IS3 family transposase -
  H0501_RS06895 (STHERMO_1528) pta 1334881..1335864 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  H0501_RS06900 (STHERMO_1529) - 1335878..1336774 (-) 897 WP_179970626.1 RluA family pseudouridine synthase -
  H0501_RS06905 (STHERMO_1530) - 1336771..1337607 (-) 837 WP_041827075.1 NAD kinase -
  H0501_RS06910 (STHERMO_1531) - 1337579..1338253 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  H0501_RS06915 (STHERMO_1532) - 1338349..1338924 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  H0501_RS06920 (STHERMO_1533) - 1339289..1340260 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  H0501_RS06925 (STHERMO_1534) - 1340264..1341376 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  H0501_RS06930 (STHERMO_1535) - 1341378..1341725 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  H0501_RS06935 (STHERMO_1536) - 1341869..1342528 (+) 660 WP_011681430.1 redox-sensing transcriptional repressor Rex -
  H0501_RS06940 (STHERMO_1537) - 1342521..1343216 (+) 696 WP_179970625.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  H0501_RS06945 (STHERMO_1538) radC 1343269..1343955 (-) 687 WP_011226324.1 RadC family protein -
  H0501_RS06950 (STHERMO_1539) - 1344003..1345646 (-) 1644 WP_095559418.1 rhamnan synthesis F family protein -
  H0501_RS06955 (STHERMO_1540) - 1345647..1346849 (-) 1203 WP_014608559.1 ABC transporter ATP-binding protein -
  H0501_RS06960 (STHERMO_1541) - 1346849..1347655 (-) 807 WP_014608560.1 ABC transporter permease -
  H0501_RS06965 (STHERMO_1542) - 1347656..1348594 (-) 939 WP_065972455.1 glycosyltransferase family 2 protein -
  H0501_RS06970 (STHERMO_1543) cps2T 1348591..1349739 (-) 1149 WP_065972456.1 beta 1-4 rhamnosyltransferase Cps2T -
  H0501_RS06975 (STHERMO_1545) - 1349939..1351456 (-) 1518 WP_179970624.1 glucosyltransferase domain-containing protein -
  H0501_RS06980 (STHERMO_1546) - 1351473..1352720 (-) 1248 WP_101415660.1 glycosyltransferase family 4 protein -
  H0501_RS06985 (STHERMO_1547) - 1352724..1354031 (-) 1308 WP_179970623.1 DUF2142 domain-containing protein -
  H0501_RS06990 (STHERMO_1548) - 1354018..1357032 (-) 3015 WP_179970622.1 rhamnan synthesis F family protein -
  H0501_RS06995 (STHERMO_1549) - 1357243..1358445 (-) 1203 WP_179970621.1 hypothetical protein -
  H0501_RS07000 (STHERMO_1551) - 1358916..1359692 (-) 777 WP_179970620.1 glycosyltransferase family 2 protein -
  H0501_RS07005 (STHERMO_1552) - 1359682..1360038 (-) 357 WP_011681441.1 DUF2304 domain-containing protein -
  H0501_RS07010 (STHERMO_1553) - 1360038..1360754 (-) 717 WP_041827367.1 glycosyltransferase family 2 protein -
  H0501_RS07015 (STHERMO_1554) - 1360784..1361776 (-) 993 WP_179970619.1 glycosyltransferase family 8 protein -
  H0501_RS10580 - 1362605..1362700 (-) 96 WP_374110359.1 glycosyltransferase -
  H0501_RS07020 (STHERMO_1556) glf 1362714..1363823 (-) 1110 WP_179970618.1 UDP-galactopyranose mutase -
  H0501_RS07025 (STHERMO_1557) - 1363826..1365283 (-) 1458 WP_179970617.1 flippase -
  H0501_RS07030 (STHERMO_1558) - 1365280..1366038 (-) 759 WP_179970616.1 DUF4422 domain-containing protein -
  H0501_RS07035 (STHERMO_1559) rfbD 1366376..1367227 (-) 852 WP_100284792.1 dTDP-4-dehydrorhamnose reductase -
  H0501_RS07040 (STHERMO_1560) - 1367300..1368559 (-) 1260 WP_232086458.1 DUF2142 domain-containing protein -
  H0501_RS07045 (STHERMO_1561) - 1368614..1369540 (-) 927 WP_179970615.1 glycosyltransferase family 2 protein -
  H0501_RS07050 (STHERMO_1562) - 1369551..1369886 (-) 336 WP_179970614.1 metal-sulfur cluster assembly factor -
  H0501_RS07055 (STHERMO_1563) rpoD 1369940..1371049 (-) 1110 WP_179970613.1 RNA polymerase sigma factor RpoD -
  H0501_RS07060 (STHERMO_1564) dnaG 1371053..1372864 (-) 1812 WP_116920323.1 DNA primase -
  H0501_RS07065 (STHERMO_1565) rpsU 1373235..1373411 (-) 177 WP_011226340.1 30S ribosomal protein S21 -
  H0501_RS07070 (STHERMO_1566) - 1373606..1374400 (-) 795 WP_014621826.1 ABC transporter substrate-binding protein -
  H0501_RS07075 (STHERMO_1567) - 1374493..1375602 (-) 1110 WP_014727642.1 aminotransferase -
  H0501_RS07080 (STHERMO_1568) - 1375949..1376746 (-) 798 WP_002951495.1 transporter substrate-binding domain-containing protein -
  H0501_RS07085 (STHERMO_1569) - 1376743..1377573 (-) 831 WP_022097022.1 transporter substrate-binding domain-containing protein -
  H0501_RS07090 (STHERMO_1570) - 1377787..1378251 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  H0501_RS07095 (STHERMO_1571) uvrB 1378296..1380287 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  H0501_RS07100 - 1380399..1380650 (+) 252 WP_179970612.1 hypothetical protein -
  H0501_RS07105 - 1380974..1381910 (-) 937 Protein_1362 CPBP family intramembrane glutamic endopeptidase -
  H0501_RS07110 (STHERMO_1576) - 1382108..1384318 (+) 2211 WP_179970841.1 ABC transporter substrate-binding protein/permease -
  H0501_RS07115 (STHERMO_1577) - 1384318..1385058 (+) 741 WP_011681459.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=1130508 H0501_RS06845 WP_002946409.1 1324971..1325897(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_18]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=1130508 H0501_RS06845 WP_002946409.1 1324971..1325897(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_18]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1

  amiD Streptococcus thermophilus LMD-9

100

100

1

  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964


Multiple sequence alignment