Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   FX000_RS13200 Genome accession   NZ_LR698983
Coordinates   2533515..2533691 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis isolate MGYG-HGUT-02357     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2528515..2538691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FX000_RS13185 gcvT 2529157..2530251 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  FX000_RS13190 - 2530844..2532523 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  FX000_RS13195 - 2532530..2533324 (+) 795 WP_003183441.1 YqhG family protein -
  FX000_RS13200 sinI 2533515..2533691 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  FX000_RS13205 sinR 2533725..2534060 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  FX000_RS13210 tasA 2534165..2534959 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  FX000_RS13215 sipW 2535033..2535617 (-) 585 WP_003183449.1 signal peptidase I SipW -
  FX000_RS13220 tapA 2535614..2536342 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  FX000_RS13225 - 2536619..2536939 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  FX000_RS13230 - 2536963..2537145 (-) 183 WP_003183456.1 YqzE family protein -
  FX000_RS13235 comGG 2537234..2537599 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  FX000_RS13240 comGF 2537612..2538100 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  FX000_RS13245 comGE 2538009..2538356 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=1128879 FX000_RS13200 WP_003183444.1 2533515..2533691(+) (sinI) [Bacillus licheniformis isolate MGYG-HGUT-02357]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=1128879 FX000_RS13200 WP_003183444.1 2533515..2533691(+) (sinI) [Bacillus licheniformis isolate MGYG-HGUT-02357]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment